| PDBID: | 8ttu | | Status: | HOLD -- hold until a certain date | | Title: | Structure of SNX27 FERM complexed with Fam21A repeat 19 (1261 - 1274) | | Authors: | Guo, Q., Chen, K.-E., Collins, B.M. | | Deposition date: | 2023-08-15 | | Release date: | 2024-08-15 |
|
| PDBID: | 8ttv | | Status: | HOLD -- hold until a certain date | | Title: | Structure of SNX27 FERM complexed with Fam21A repeat 20 (1289-1302) | | Authors: | Guo, Q., Chen, K.-E., Collins, B.M. | | Deposition date: | 2023-08-15 | | Release date: | 2024-08-15 |
|
| PDBID: | 8tu7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-15 |
|
| PDBID: | 8tu8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-15 |
|
| PDBID: | 8q6q | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-14 |
|
| PDBID: | 8q6n | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-14 |
|
| PDBID: | 8q6r | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-08-14 | | Release date: | 2024-08-14 |
|
| PDBID: | 8kex | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-08-14 | | Release date: | 2025-02-14 |
|
| PDBID: | 8ttq | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-08-14 | | Release date: | 2024-12-31 |
|
| PDBID: | 8ttr | | Status: | HPUB -- hold until publication | | Title: | CA9 mimic bound to SH7 | | Authors: | Peat, T.S. | | Deposition date: | 2023-08-14 |
|
| PDBID: | 8q6l | | Status: | HPUB -- hold until publication | | Title: | human Carbonic Anhydrase I in complex with 3,4-dihydro-1H-benzo[c][1,2]oxaborinin-1-ol | | Authors: | Angeli, A., Ferraroni, M. | | Deposition date: | 2023-08-13 | | Sequence: | >Entity 1
MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
|
|
| PDBID: | 8ket | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Cryo-EM structure of human complex A | | Authors: | Qian, H.W., He, J.J. | | Deposition date: | 2023-08-13 | | Release date: | 2025-02-13 |
|
| PDBID: | 8kev | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2023-08-13 | | Release date: | 2025-02-13 |
|
| PDBID: | 8kes | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2023-08-13 | | Release date: | 2025-02-13 |
|
| PDBID: | 8tt8 | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Joint Xray/Neutron structure of Macrophage Migration Inhibitory Factor (MIF) Bound to 4-hydroxyphenylpyruvate at room temperature | | Authors: | Schroder, G.C., Meilleur, F., Crichlow, G.V., Lolis, E.J. | | Deposition date: | 2023-08-13 |
|
| PDBID: | 8tt9 | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of Macrophage Migration Inhibitory Factor (MIF) Covalently Bound to 4-hydroxyphenylpyruvate (HPP) | | Authors: | Schroder, G.C., Meilleur, F., Nix, J.C., Crichlow, G.V., Lolis, E.J. | | Deposition date: | 2023-08-13 | | Sequence: | >Entity 1
PMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
|
|
| PDBID: | 8tta | | Status: | HOLD -- hold until a certain date | | Title: | Structure of retromer VPS29-VPS35 (483-796) complexed with Fam21A repeat 21 (1328-1341) | | Authors: | Chen, K.-E., Guo, Q., Collins, B.M. | | Deposition date: | 2023-08-13 | | Release date: | 2024-08-13 |
|
| PDBID: | 8ttc | | Status: | HOLD -- hold until a certain date | | Title: | Structure of retromer VPS29-VPS35 (483-796) complexed with Fam21A repeat 20 (1289-1302) | | Authors: | Chen, K.-E., Guo, Q., Collins, B.M. | | Deposition date: | 2023-08-13 | | Release date: | 2024-08-13 |
|
| PDBID: | 8ttd | | Status: | HOLD -- hold until a certain date | | Title: | Structure of VPS29 complexed with Fam21A repeat 21 (1328-1341) | | Authors: | Chen, K.-E., Guo, Q., Collins, B.M. | | Deposition date: | 2023-08-13 | | Release date: | 2024-08-13 |
|
| PDBID: | 8ken | | Status: | HPUB -- hold until publication | | Title: | Structure of DexA reveal the novel mechanism of DNA catalysis | | Authors: | Liu, Y.H., Ma, B., Kang, Y., Liu, B., Li, Y. | | Deposition date: | 2023-08-12 |
|
| PDBID: | 8kel | | Status: | HPUB -- hold until publication | | Title: | Structure of DexA reveal the novel Mechanism of DNA catalysis | | Authors: | Liu, Y.H., Ma, B., Kang, Y., Liu, B., Li, Y. | | Deposition date: | 2023-08-12 |
|
| PDBID: | 8q69 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of HsRNMT complexed with inhibitor DDD1060606 | | Authors: | Petit, A.P., Fyfe, P.K. | | Deposition date: | 2023-08-11 |
|
| PDBID: | 8q6d | | Status: | HPUB -- hold until publication | | Title: | Anaerobic crystal structure of HIF prolyl hydroxylase 2 (PHD2 181-407) in complex with HIF2alpha-CODD peptide (523-542), Fe(II) and 2-oxoglutarate (2OG) | | Authors: | Fiorini, G., Figg Jr, W.D., Schofield, C.J. | | Deposition date: | 2023-08-11 |
|
| PDBID: | 8q6e | | Status: | HPUB -- hold until publication | | Title: | Aerobic crystal structure of HIF prolyl hydroxylase 2 (PHD2 181-407) in complex with Fe(III), 2-oxoglutarate (2OG) and HIF2alpha-CODD peptide | | Authors: | Fiorini, G., Figg Jr, W.D., Schofield, C.J. | | Deposition date: | 2023-08-11 |
|
| PDBID: | 8keb | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-08-11 | | Release date: | 2025-02-11 |
|
