| PDBID: | 8xtu | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Rab5b GTPase domain from Leishmania donovani in complex with GDP | | Authors: | Zohib, M., Pal, R.K., Biswal, B.K., Arora, A. | | Deposition date: | 2024-01-11 |
|
| PDBID: | 8xtq | | Status: | HPUB -- hold until publication | | Title: | CryoEM Structure of intron 2 | | Authors: | Wang, L., Xie, J.H., Zhang, C., Zou, J., Huang, Z.R., Shang, S.T., Chen, X.Y., Yang, Y., Dong, H.H., Huang, D.M., Su, Z.M. | | Deposition date: | 2024-01-11 |
|
| PDBID: | 8xtr | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-11 |
|
| PDBID: | 8xtp | | Status: | HPUB -- hold until publication | | Title: | CryoEM Structure of intron 4 | | Authors: | Wang, L., Xie, J.H., Zhang, C., Zou, J., Huang, Z.R., Shang, S.T., Chen, X.Y., Yang, Y., Dong, H.H., Huang, D.M., Su, Z.M. | | Deposition date: | 2024-01-11 |
|
| PDBID: | 8xts | | Status: | HPUB -- hold until publication | | Title: | CryoEM Structure of intron | | Authors: | Wang, L., Xie, J.H., Zhang, C., Zou, J., Huang, Z.R., Shang, S.T., Chen, X.Y., Yang, Y., Dong, H.H., Huang, D.M., Su, Z.M. | | Deposition date: | 2024-01-11 |
|
| PDBID: | 8xtv | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of AaHPPD-Y14150 complex | | Authors: | Dong, J., Lin, H.-Y., Yang, G.-F. | | Deposition date: | 2024-01-11 |
|
| PDBID: | 8rns | | Status: | HPUB -- hold until publication | | Title: | Human Carbonic Anhydrase XII mimic in complex with biguanide derivative inhibitor 1-carbamimidamido-N-[(4 sulfamoylphenyl)methyl]methanimidamide | | Authors: | Baroni, C., Ferraroni, M. | | Deposition date: | 2024-01-10 | | Sequence: | >Entity 1
MSHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHSFKVNFDDSQDKAVLKGGPLDGTYRLTQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDASKASQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLNETVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
|
|
| PDBID: | 8rni | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8vky | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8vkx | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8vkv | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8vkw | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8xsu | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8xt7 | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of human AS3MT | | Authors: | Chun, I.S., Kim, M.S. | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8xsv | | Status: | HOLD -- hold until a certain date | | Title: | crystal structure of PPAT mutant P8A | | Authors: | Yin, H.S. | | Deposition date: | 2024-01-10 | | Release date: | 2025-01-10 |
|
| PDBID: | 8xtc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8xsw | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8xt6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8xt8 | | Status: | HPUB -- hold until publication | | Title: | Clostridioides difficile MarR (WP_003434724) with Hg-bound | | Authors: | Park, S., Kwon, N. | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8xta | | Status: | HPUB -- hold until publication | | Title: | Clostridioides difficile MarR (WP_003434724) | | Authors: | Park, S., Kwon, N. | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8xt9 | | Status: | HPUB -- hold until publication | | Title: | structure of LGR4 | | Authors: | Wang, L., Geng, Y. | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8xtb | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8xtd | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8xt5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8rmx | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-09 |
|
