PDBID: | 8zu5 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal Structure of Methyl parathion hydrolase mutant A66D/I143V/I145L/Q272D/S279A/ | Authors: | Xu, F., Fan, S. | Deposition date: | 2024-06-07 |
|
PDBID: | 8zu1 | Status: | HOLD -- hold until a certain date | Deposition date: | 2024-06-07 | Release date: | 2025-06-07 |
|
PDBID: | 8ztd | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-06-07 | Release date: | 2025-06-07 |
|
PDBID: | 8ztf | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-06-07 | Release date: | 2025-06-07 |
|
PDBID: | 8ztp | Status: | HPUB -- hold until publication | Title: | Crystal structure of cysteine desulfurase Sufs from Mycoplasma Pneumonia | Authors: | Wang, W.M., Ma, D.Y., Gong, W.J., Yao, H., Liu, Y.H., Wang, H.F. | Deposition date: | 2024-06-07 |
|
PDBID: | 8ztq | Status: | HPUB -- hold until publication | Title: | Crystal structure of Sufu from Mycoplasma Pneumonia | Authors: | Wang, W.M., Ma, D.Y., Gong, W.J., Yao, H., Liu, Y.H., Wang, H.F. | Deposition date: | 2024-06-07 |
|
PDBID: | 8ztr | Status: | HPUB -- hold until publication | Title: | The dimer complex of DSR2 and tube-forming domain of phage tail tube protein | Authors: | Zheng, J., Yang, X. | Deposition date: | 2024-06-07 |
|
PDBID: | 8zu0 | Status: | HOLD -- hold until a certain date | Title: | CryoEM structure of a tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA | Authors: | Jiang, W.X., Cheng, X.Q., Dong, X., Ma, L.X., Xing, Q. | Deposition date: | 2024-06-07 | Release date: | 2025-06-07 |
|
PDBID: | 8ztw | Status: | HOLD -- hold until a certain date | Title: | CryoEM structure of a GH1 family beta-glucosidase | Authors: | Jiang, W.X., Cheng, X.Q., Ma, L.X., Cao, Z., Xing, Q. | Deposition date: | 2024-06-07 | Release date: | 2025-06-07 |
|
PDBID: | 8zu2 | Status: | HPUB -- hold until publication | Title: | Crystal Structure of Human Myt1 Kinase domain Bounded with compound 39 | Authors: | Zhang, Z.M., Zhou, Z.Q. | Deposition date: | 2024-06-07 |
|
PDBID: | 8ztx | Status: | HPUB -- hold until publication | Title: | Crystal Structure of Human Myt1 Kinase domain Bounded with compound 39 | Authors: | Zhang, Z.M., Zhou, Z.Q. | Deposition date: | 2024-06-07 |
|
PDBID: | 8zts | Status: | HPUB -- hold until publication | Deposition date: | 2024-06-07 |
|
PDBID: | 8ztu | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-06-07 |
|
PDBID: | 8ztt | Status: | HPUB -- hold until publication | Deposition date: | 2024-06-07 |
|
PDBID: | 8zth | Status: | HPUB -- hold until publication | Deposition date: | 2024-06-07 |
|
PDBID: | 8ztz | Status: | HOLD -- hold until a certain date | Deposition date: | 2024-06-07 | Release date: | 2025-06-07 |
|
PDBID: | 9c6l | Status: | HPUB -- hold until publication | Deposition date: | 2024-06-07 |
|
PDBID: | 9c6m | Status: | HPUB -- hold until publication | Deposition date: | 2024-06-07 |
|
PDBID: | 9c69 | Status: | HPUB -- hold until publication | Title: | The CRISPR associated CARF-adenosine deaminase, Cad1-CARF in the cA4 bound form | Authors: | Majumder, P., Patel, D.J. | Deposition date: | 2024-06-07 |
|
PDBID: | 9c68 | Status: | HPUB -- hold until publication | Title: | The CRISPR associated CARF-adenosine deaminase Cad1-CARF in the cA6 bound form | Authors: | Majumder, P., Patel, D.J. | Deposition date: | 2024-06-07 |
|
PDBID: | 9c63 | Status: | HPUB -- hold until publication | Deposition date: | 2024-06-07 |
|
PDBID: | 9c64 | Status: | HPUB -- hold until publication | Deposition date: | 2024-06-07 |
|
PDBID: | 9c65 | Status: | HPUB -- hold until publication | Deposition date: | 2024-06-07 | Sequence: | >Entity 1 STLEVRSQATQDLSEYYNRPYFDLRNLSGYREGNTVTFINHYQQTDVKLEGKDKDKIKDGNNENLDVFVVREGSGRQADNNSIGGITKTNRTQHIDTVQNVNLLVSKSTGQHTTSVTSTNYSIYKEEISLKELDFKLRKHLIDKHDLYKTEPKDSKIRVTMKNGDFYTFELNKKLQTHRMGDVIDGRNIEKIEVNL
|
|
PDBID: | 9c6o | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Title: | Multiple independent acquisitions of ACE2 usage in MERS-related coronaviruses | Authors: | Park, Y.J., Seattle Structural Genomics Center for Infectious Diseases, Veesler, D., Seattle Structural Genomics Center for Infectious Disease (SSGCID) | Deposition date: | 2024-06-07 |
|
PDBID: | 9c62 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-06-07 |
|