| PDBID: | 8wzg | | Status: | HPUB -- hold until publication | | Title: | SFX structure of an Mn-carbonyl complex immobilized in hen egg white lysozyme microcrystals, 10 ns after photoexcitation at RT. | | Authors: | Maity, B., Shoji, M., Luo, F., Nakane, T., Abe, S., Owada, S., Kang, J., Tono, K., Tanaka, R., Thuc, T.T., Kojima, M., Hishikawa, Y., Tanaka, J., Tian, J., Noya, H., Nakasuji, Y., Asanuma, A., Yao, X., Iwata, S., Shigeta, Y., Nango, E., Ueno, T. | | Deposition date: | 2023-11-01 |
|
| PDBID: | 8wyl | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Ryanodine receptor 1 (100 nM Ca2+, open state) | | Authors: | Qiang, C., Hongli, H. | | Deposition date: | 2023-10-31 |
|
| PDBID: | 8r0n | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-31 |
|
| PDBID: | 8r0o | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-31 |
|
| PDBID: | 8r0k | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-31 |
|
| PDBID: | 8r0l | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-31 |
|
| PDBID: | 8r0m | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-31 |
|
| PDBID: | 8r0p | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-31 |
|
| PDBID: | 8r0t | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-10-31 | | Release date: | 2024-10-31 |
|
| PDBID: | 8r0c | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-31 |
|
| PDBID: | 8r0d | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Borneoldehydrogenase ancestor N39 | | Authors: | Helmer, C.P.O., Dimos, N., Loll, B. | | Deposition date: | 2023-10-31 |
|
| PDBID: | 8r0h | | Status: | HPUB -- hold until publication | | Title: | Pim1 in complex with (E)-3-(2-(thiophen-2-yl)vinyl)-3,4-dihydroquinoxalin-2(1H)-one and Pimtide | | Authors: | Hochban, P.M.M., Heine, A., Diederich, W.E. | | Deposition date: | 2023-10-31 | | Sequence: | >Entity 1
SMLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDIPFEHDEEIIGGQVFFRQRVS(SEP)ECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSPGPS
>Entity 2
ARKRRRHPSGPPTA
|
|
| PDBID: | 8r0q | | Status: | HPUB -- hold until publication | | Title: | Pim1 in complex with 6-bromo-1H-benzo[d]imidazol-2-amine and Pimtide | | Authors: | Hochban, P.M.M., Heine, A., Diederich, W.E. | | Deposition date: | 2023-10-31 | | Sequence: | >Entity 1
SMLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDIPFEHDEEIIGGQVFFRQRVS(SEP)ECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSPGPS
>Entity 2
ARKRRRHPSGPPTA
|
|
| PDBID: | 8r0s | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-31 |
|
| PDBID: | 8uu0 | | Status: | HPUB -- hold until publication | | Title: | E3 ubiquitin-protein ligase CBL-B in complex with compound 6 | | Authors: | Gajewski, S., Clifton, M.C. | | Deposition date: | 2023-10-31 |
|
| PDBID: | 8uu1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-31 |
|
| PDBID: | 8uti | | Status: | HPUB -- hold until publication | | Title: | Eukaryotic 80S ribosome with Reh1 and A/P site tRNA | | Authors: | Yelland, J.N., Taylor, D.W., Johnson, A.W. | | Deposition date: | 2023-10-31 |
|
| PDBID: | 8uu2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-31 |
|
| PDBID: | 8uu3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-31 |
|
| PDBID: | 8uth | | Status: | HPUB -- hold until publication | | Title: | Active site binding triggers E1-rearrangements revealing E1-E2 lipoyl domain interactions in the Pyruvate dehydrogenase complex | | Authors: | Arjunan, P., Whitley, M., Furey, W. | | Deposition date: | 2023-10-31 |
|
| PDBID: | 8utj | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-10-31 |
|
| PDBID: | 8utm | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-10-31 | | Release date: | 2024-10-31 |
|
| PDBID: | 8utz | | Status: | HPUB -- hold until publication | | Title: | E3 ubiquitin-protein ligase CBL-B in complex with compound 2 | | Authors: | Gajewski, S., Clifton, M.C. | | Deposition date: | 2023-10-31 |
|
| PDBID: | 8wyq | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-31 |
|
| PDBID: | 8wyr | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-31 |
|
