| PDBID: | 9udm | | Status: | HPUB -- hold until publication | | Title: | Cocrystal structure of human cytosolic phenylalanyl-tRNA synthetase and an inhibitor in the presence of ATP | | Authors: | Qiao, H., Hei, Z., Fang, P. | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9o3d | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of broadly neutralizing antibody HEPC108 in complex with Hepatitis C virus envelope glycoprotein E2 ectodomain | | Authors: | Flyak, A.I., Wilcox, X.E. | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9o3g | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-04-07 | | Release date: | 2026-04-07 |
|
| PDBID: | 9o3v | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9o3w | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9o3x | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9o3y | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9o3u | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-07 | | Sequence: | >Entity 1
PFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSIGVVGTAEDNRSHSAHFFEFLTKELALGQDRILIRFFPLESWQIGAIGTVMTFL
|
|
| PDBID: | 9o3t | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-07 | | Sequence: | >Entity 1
PFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISAIGVVGTAEDNRSHSAHFFEFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFL
|
|
| PDBID: | 9o3s | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-07 | | Sequence: | >Entity 1
PFLELDTNLPANRVPAGLEKRLCAAAASILGKPADAVNVTVRPGLAMALSGSTEPCAQLSISSIGVVGTAEDNRSHSAHFFEFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFL
|
|
| PDBID: | 9o3e | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9o39 | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Cryo-EM structure of the E. coli HtpG N-terminal and middle domain dimer in complex with AMPPNP | | Authors: | Jiang, L., Ye, Q., Boyenle, I.D., Liu, Y. | | Deposition date: | 2025-04-07 | | Release date: | 2026-04-07 |
|
| PDBID: | 9o3f | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9o3c | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Cryo-EM structure of the cyanobacterial HtpG N-terminal and middle domain dimer in complex with AMPPNP in a fully closed state | | Authors: | Jiang, L., Ye, Q., Boyenle, I.D., Liu, Y. | | Deposition date: | 2025-04-07 | | Release date: | 2026-04-07 |
|
| PDBID: | 9o3a | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Cryo-EM structure of the cyanobacterial HtpG N-terminal and middle domain dimer in complex with AMPPNP in a semi-closed state | | Authors: | Jiang, L., Ye, Q., Boyenle, I.D., Liu, Y. | | Deposition date: | 2025-04-07 | | Release date: | 2026-04-07 |
|
| PDBID: | 9o3r | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of I64A Variant of D-Dopachrome Tautomerase (D-DT) | | Authors: | Pilien, A.V.R., Argueta, C., Parkins, A., Pantouris, G. | | Deposition date: | 2025-04-07 | | Sequence: | >Entity 1
PFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSAGVVGTAEDNRSHSAHFFEFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFL
|
|
| PDBID: | 9o3o | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-04-07 | | Release date: | 2026-04-07 |
|
| PDBID: | 9o3b | | Status: | HPUB -- hold until publication | | Title: | PKM2 bound to MCTI-566 | | Authors: | Stuckey, J.A. | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9o3n | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9o3m | | Status: | HPUB -- hold until publication | | Title: | K40F mutant of hCRBPII bound to fentanyl | | Authors: | Bingham, C., Geiger, J.H. | | Deposition date: | 2025-04-07 | | Sequence: | >Entity 1
TRDQNGTWEMESNENFEGYMKALDIDFATRKIAVRLTQTFVIDQDGDNFKTKTTSTFRNYDVDFTVGVEFDEYTKSLDNRHVKALVTWEGDVLVCVQKGEKENRGWKQWIEGDKLYLELTCGDQVCRQVFKKK
|
|
| PDBID: | 9o3p | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9qsx | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9qsy | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9qsz | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9qt4 | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of Arabidopsis TIR-NLR WRR4A tetramer in complex with effector CCG40 (focused refinement) | | Authors: | Zhao, H., Lukoyanova, N., Selvaraj, M., Jones, J. | | Deposition date: | 2025-04-07 |
|
