| PDBID: | 9q9q | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-02-26 | | Release date: | 2026-02-26 |
|
| PDBID: | 9q99 | | Status: | HPUB -- hold until publication | | Title: | CK2, catalytic subunit alpha'' (CSNK2A2 gene product) in complex with F2X-Entry screen fragment B06 | | Authors: | Werner, C., Harasimowicz, H., Barthel, T., Weiss, M.S., Niefind, K. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9q9o | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-02-26 | | Release date: | 2026-02-26 |
|
| PDBID: | 9q9u | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9q9e | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of a TELSAM-SUMO1 fusion protein | | Authors: | Coste, F., Mishra, A., Suskiewicz, M.J. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9q9t | | Status: | HPUB -- hold until publication | | Title: | Human ROCK2 in complex with a dihydropyrazolo-pyrimidine inhibitor | | Authors: | Pala, D., Clark, D., Accetta, A., Rancati, F., Edwards, C. | | Deposition date: | 2025-02-26 | | Sequence: | >Entity 1
GAAGDGAGASRQRKLEALIRDPRSPINVESLLDGLNSLVLDLDFPALRKNKNIDNFLNRYEKIVKKIRGLQMKAEDYDVVKVIGRGAFGEVQLVRHKASQKVYAMKLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWAKFYTAEVVLALDAIHSMGLIHRDVKPDNMLLDKHGHLKLADFGTCMKMDETGMVHCDTAVGTPDYISPEVLKSQGGDGFYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMDHKNSLCFPEDAEISKHAKNLICAFLTDREVRLGRNGVEEIRQHPFFKNDQWHWDNIRETAAPVVPELSSDIDSSNFDDIEDDKGDVETFPIPKAFVGNQLPFIGFTYYR
|
|
| PDBID: | 9q92 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | CryoEM structure of bacterial transcription intermediate complex mediated by activator PspF containing nifH promoter DNA containing mismatch from -11 to -8 - conformation 5 | | Authors: | Gao, F., Zhang, X. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9q9a | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9q9b | | Status: | HPUB -- hold until publication | | Title: | CK2, catalytic subunit alpha'' (CSNK2A2 gene product) in complex with F2X-Entry screen fragment C07 | | Authors: | Werner, C., Harasimowicz, H., Barthel, T., Weiss, M.S., Niefind, K. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9q9c | | Status: | HPUB -- hold until publication | | Title: | CK2, catalytic subunit alpha'' (CSNK2A2 gene product) in complex with F2X-Entry screen fragment D04 | | Authors: | Werner, C., Harasimowicz, H., Barthel, T., Weiss, M.S., Niefind, K. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9q9r | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-02-26 | | Release date: | 2026-02-26 |
|
| PDBID: | 9q9d | | Status: | HPUB -- hold until publication | | Title: | CK2, catalytic subunit alpha'' (CSNK2A2 gene product) in complex with F2X-Entry screen fragment D04 and CX-4945 (Silmitasertib) | | Authors: | Werner, C., Harasimowicz, H., Barthel, T., Weiss, M.S., Niefind, K. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9q9g | | Status: | HPUB -- hold until publication | | Title: | CK2, catalytic subunit alpha'' (CSNK2A2 gene product) in complex with F2X-Entry screen fragment D10 | | Authors: | Werner, C., Harasimowicz, H., Barthel, T., Weiss, M.S., Niefind, K. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9q9v | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Borrelia burgdorferi BB0238-BB0323 complex | | Authors: | Brangulis, K. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9q9i | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9m0o | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of OPTN 138-170 in complex with GTP-bound RAB8A1-176 (Q67L) | | Authors: | Okatsu, K., Fukai, S. | | Deposition date: | 2025-02-25 |
|
| PDBID: | 9m0x | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the agmatine-bound zTAAR13d-Gs complex | | Authors: | Zheng, Y., Zhao, S.W. | | Deposition date: | 2025-02-25 |
|
| PDBID: | 9m0u | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Study on zine figer structure and fuction of tumor suppressor ZMYND11 | | Authors: | Bai, X., Chen, Z. | | Deposition date: | 2025-02-25 | | Release date: | 2026-02-25 |
|
| PDBID: | 9m0p | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-25 |
|
| PDBID: | 9m0r | | Status: | HPUB -- hold until publication | | Title: | Structure of neuropeptide FF receptor 1 complex with NPVF | | Authors: | Pan, B.X., Jiang, Y., Li, X.Z. | | Deposition date: | 2025-02-25 |
|
| PDBID: | 9m0y | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-25 |
|
| PDBID: | 9m0k | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-25 |
|
| PDBID: | 9m1f | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of E. coli tryptophanyl-tRNA synthetase complexed with chuangxinmycin and ATP in closed-closed state | | Authors: | Ren, Y., Wang, S., Liu, W., Fang, P. | | Deposition date: | 2025-02-25 |
|
| PDBID: | 9m17 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-25 |
|
| PDBID: | 9m18 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-25 |
|
