| PDBID: | 9nhx | | Status: | HPUB -- hold until publication | | Title: | The cryo-EM structure of the periplasmic chaperone Skp from Neisseria meningitidis | | Authors: | Dubey, S., Noinaj, N. | | Deposition date: | 2025-02-25 |
|
| PDBID: | 9ni8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-25 |
|
| PDBID: | 9nhq | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-25 |
|
| PDBID: | 9nhy | | Status: | HPUB -- hold until publication | | Title: | Fab1502 in complex with the C-terminal alpha-TSR domain of the P. falciparum circumsporozoite protein | | Authors: | Moskovitz, R., Wilson, I.A. | | Deposition date: | 2025-02-25 |
|
| PDBID: | 9nhv | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-25 |
|
| PDBID: | 9nia | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-25 |
|
| PDBID: | 9nhs | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of SIWI-piRNA-target(39-nt)-GTSF1-Maelstrom-Spindle-E complex | | Authors: | Sarkar, S., Gebert, L.F.R., MacRae, I.J. | | Deposition date: | 2025-02-25 |
|
| PDBID: | 9nhz | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-25 |
|
| PDBID: | 9nib | | Status: | HPUB -- hold until publication | | Title: | Black sea bass polyomavirus LTA NLS bound to improtin alpha 2 | | Authors: | Hoad, M., Forwood, J.K., Alvisi, G. | | Deposition date: | 2025-02-25 |
|
| PDBID: | 9nhr | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of structure of WT BfrB from Pseudomonas aeruginosa in complex with a protein-protein interaction inhibitor KM-5-25 | | Authors: | Lovell, S., Seibold, S., Battaile, K.P., Yao, H., Rivera, M. | | Deposition date: | 2025-02-25 |
|
| PDBID: | 9nht | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of structure of WT BfrB from Pseudomonas aeruginosa in complex with a protein-protein interaction inhibitor KM-5-35 | | Authors: | Lovell, S., Seibold, S., Battaile, K.P., Yao, H., Rivera, M. | | Deposition date: | 2025-02-25 |
|
| PDBID: | 9nhu | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-25 |
|
| PDBID: | 9ni1 | | Status: | HPUB -- hold until publication | | Title: | Fab389 in complex with the C-terminal alpha-TSR domain of the P. falciparum circumsporozoite protein | | Authors: | Moskovitz, R., Wilson, I.A. | | Deposition date: | 2025-02-25 |
|
| PDBID: | 9ni2 | | Status: | HPUB -- hold until publication | | Title: | Fab369 in complex with the C-terminal alpha-TSR domain of the P. falciparum circumsporozoite protein | | Authors: | Moskovitz, R., Wilson, I.A. | | Deposition date: | 2025-02-25 |
|
| PDBID: | 9nhw | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-25 |
|
| PDBID: | 9ni3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-25 |
|
| PDBID: | 9q8o | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Hsp82-MD in complex with the CS domain of Sgt1 | | Authors: | Lopez, A., Napolitano, V., Delhommel, F., Popowicz, G.M., Sattler, M. | | Deposition date: | 2025-02-25 |
|
| PDBID: | 9q8r | | Status: | HPUB -- hold until publication | | Title: | Human ROCK1 in complex with a dihydropyrazolo-pyrimidine inhibitor | | Authors: | Pala, D., Clark, D., Accetta, A., Rancati, F., Edwards, C. | | Deposition date: | 2025-02-25 | | Sequence: | >Entity 1
GASFETRFEKMDNLLRDPKSEVNSDCLLDGLDALVYDLDFPALRKNKNIDNFLSRYKDTINKIRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKSTRKVYAMKLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWARFYTAEVVLALDAIHSMGFIHRDVKPDNMLLDKSGHLKLADFGTCMKMNKEGMVRCDTAVGTPDYISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNSLTFPDDNDISKEAKNLICAFLTDREVRLGRNGVEEIKRHLFFKNDQWAWETLRDTVAPVVPDLSSDIDTSNFDDLEEDKGEEETFPIPKAFVGNQLPFVGFTYYSNRRY
|
|
| PDBID: | 9q8n | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-25 |
|
| PDBID: | 9q8y | | Status: | HPUB -- hold until publication | | Title: | Structure of RNF38 RING with linchpin mutant R454Y in complex with Ubch5B-Ub | | Authors: | Gabrielsen, M., Buetow, L., Huang, D.T. | | Deposition date: | 2025-02-25 |
|
| PDBID: | 9q8t | | Status: | HPUB -- hold until publication | | Title: | Nociceptive properties of U5-theraphotoxin-Hs1b, a novel peptide from the Cyriopagopus schmidti spider, active on NaV1.7 channel | | Authors: | Meudal, H., Landon, C. | | Deposition date: | 2025-02-25 |
|
| PDBID: | 9q8x | | Status: | HPUB -- hold until publication | | Title: | Ku70/80 bound to a 153 bp H2AX nucleosome | | Authors: | Hall, C., Chaplin, A.K. | | Deposition date: | 2025-02-25 |
|
| PDBID: | 9q8p | | Status: | HPUB -- hold until publication | | Title: | Structure characterization and anticancer potential of the fungal immunomodulatory protein FIP-ach | | Authors: | Wszolek, A., Patel, S.N., Dubin, G. | | Deposition date: | 2025-02-25 |
|
| PDBID: | 9q8u | | Status: | HPUB -- hold until publication | | Title: | Complex of Caprine Serum Albumin with Cefaclor | | Authors: | Duszynski, K., Talaj, J.A., Bujacz, A., Bujacz, G. | | Deposition date: | 2025-02-25 | | Sequence: | >Entity 1
DTHKSEIAHRFNDLGEENFQGLVLIAFSQYLQQCPFDEHVKLVKELTEFAKTCVADESHAGCDKSLHTLFGDELCKVATLRETYGDMADCCEKQEPERNECFLKHKDDSPDLPKLKPEPDTLCAEFKADEKKFWGKYLYEVARRHPYFYAPELLYYANKYNGVFQECCQAEDKGACLLPKIETMREKVLASSARQRLRCASIQKFGERALKAWSVARLSQKFPKADFTDVTKIVTDLTKVHKECCHGDLLECADDRADLAKYICDHQDTLSSKLKECCDKPVLEKSHCIAEIDKDAVPENLPPLTADFAEDKEVCKNYQEAKDVFLGSFLYEYSRRHPEYAVSVLLRLAKEYEATLEDCCAKEDPHACYATVFDKLKHLVDEPQNLIKKNCELFEKHGEYGFQNALIVRYTRKAPQVSTPTLVEISRSLGKVGTKCCAKPESERMPCTEDYLSLILNRLCVLHEKTPVSAKVTKCCTESLVNRRPCFSDLTLDETYVPKPFDGESFTFHADICTLPDTEKQIKKQTALVELLKHKPKATDEQLKTVMENFVAFVDKCCAADDKEGCFLLEGPKLVASTQAALA
|
|
| PDBID: | 9q8v | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-25 |
|
