| PDBID: | 8y2n | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-01-26 | | Release date: | 2025-01-26 |
|
| PDBID: | 8y2k | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of QX006N-Fab | | Authors: | Li, W., Feng, W. | | Deposition date: | 2024-01-26 |
|
| PDBID: | 8y2m | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-01-26 | | Release date: | 2025-01-26 |
|
| PDBID: | 8y2j | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-26 |
|
| PDBID: | 8y2o | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-26 |
|
| PDBID: | 8rsx | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-25 |
|
| PDBID: | 8rsz | | Status: | HPUB -- hold until publication | | Title: | TRYPTOPHAN SYNTHASE measured via serial crystallography from a kapton HARE-chip (125 micron) | | Authors: | Sung, S., Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., von Stetten, D., Mehrabi, P., Schulz, E.C., Wilmanns, M. | | Deposition date: | 2024-01-25 |
|
| PDBID: | 8rsy | | Status: | HPUB -- hold until publication | | Title: | TRYPTOPHAN SYNTHASE measured via serial crystallography from a kapton HARE-chip (50 micron) | | Authors: | Sung, S., Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., von Stetten, D., Mehrabi, P., Wilmanns, M., Schulz, E.C. | | Deposition date: | 2024-01-25 |
|
| PDBID: | 8rso | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-25 |
|
| PDBID: | 8rsp | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-25 |
|
| PDBID: | 8rsq | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-25 |
|
| PDBID: | 8rsr | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-25 |
|
| PDBID: | 8rss | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-25 | | Sequence: | >Entity 1
MEELTYRLFMVATVGMLAGTVFLLASSREVKPEHRRGVYISALVCGIAWYHYQKMGASWESGSYDTGLRYVDWVLTVPLMFVEVLAVTRKGAAYNEAVRNWGIAATVMIGAGYYGETSAAGSNEYWTGFVIAMATYVWLMRNLQAEGEGLKGDQAVAFENIKNLILVGWIIYPLGYIAPVVGDFDAIREVLYTIADIIN(LYR)VGLGVLVLQMARVQSGEKVS
|
|
| PDBID: | 8rsw | | Status: | HOLD -- hold until a certain date | | Title: | Solution NMR structure of Pacsin 2 SH3 domain | | Authors: | Tossavainen, H., Permi, P. | | Deposition date: | 2024-01-25 | | Release date: | 2024-02-22 |
|
| PDBID: | 8vsz | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of human GABAA receptor pi (GABRP) apo state | | Authors: | Wang, Y., Klein, D. | | Deposition date: | 2024-01-25 |
|
| PDBID: | 8vt1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-25 |
|
| PDBID: | 8vt6 | | Status: | HPUB -- hold until publication | | Title: | A structural study of selectivity mechanisms for JNK3 and p38 alpha with indazole scaffold probing compounds | | Authors: | Park, H., Feng, Y. | | Deposition date: | 2024-01-25 |
|
| PDBID: | 8vt4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-25 |
|
| PDBID: | 8y20 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the Mcl-1 in complex with A-1210477 | | Authors: | Wang, H., Guo, M., Wei, H., Chen, Y. | | Deposition date: | 2024-01-25 |
|
| PDBID: | 8y23 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-25 |
|
| PDBID: | 8y24 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-25 |
|
| PDBID: | 8y25 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-25 |
|
| PDBID: | 8y29 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-25 |
|
| PDBID: | 8y26 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-25 |
|
| PDBID: | 8y27 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-25 |
|
