| PDBID: | 8v1z | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of monoclonal antibody 1A05 in complex with BA.1 RBD | | Authors: | Bajic, G., Alesandro, C. | | Deposition date: | 2023-11-21 |
|
| PDBID: | 8v1u | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-21 |
|
| PDBID: | 8v23 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of HIV-1 capsid N-terminal domain in the presence of Lenacapavir | | Authors: | Briganti, L., Kvaratskhelia, M. | | Deposition date: | 2023-11-21 |
|
| PDBID: | 8v1x | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of polyketide synthase (PKS) thioreductase domain from Streptomyces coelicolor | | Authors: | Pereira, J.H., Dan, Q., Keasling, J., Adams, P.D. | | Deposition date: | 2023-11-21 |
|
| PDBID: | 8v1r | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-11-21 |
|
| PDBID: | 8v1y | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-11-21 |
|
| PDBID: | 8x6e | | Status: | HOLD -- hold until a certain date | | Title: | crystal structure of the N-terminal TBF1 | | Authors: | Gao, Y., Niu, L.W. | | Deposition date: | 2023-11-21 | | Release date: | 2024-11-21 |
|
| PDBID: | 8x6d | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of the C-terminal TBF1 | | Authors: | Gao, Y., Niu, L.W. | | Deposition date: | 2023-11-21 | | Release date: | 2024-11-21 |
|
| PDBID: | 8x6l | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-21 |
|
| PDBID: | 8x6k | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-21 |
|
| PDBID: | 8x6j | | Status: | HPUB -- hold until publication | | Title: | The X-ray structure of N-terminal catalytic domain of Thermoplasma acidophilum tRNA methyltransferase Trm56 (Ta0931) in complex with S-adenosyl-L-methionine | | Authors: | Fukumoto, S., Hasegawa, T., Ototake, M., Moriguchi, S., Namba, M., Yamagamai, R., Kawamura, T., Hirata, A., Hori, H. | | Deposition date: | 2023-11-21 |
|
| PDBID: | 8x6n | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-21 |
|
| PDBID: | 8x6c | | Status: | HPUB -- hold until publication | | Title: | Complex structure of AtHPPD with YH23024 | | Authors: | Yang, G.-F., Lin, H.-Y., Dong, J. | | Deposition date: | 2023-11-21 |
|
| PDBID: | 8x6o | | Status: | HPUB -- hold until publication | | Title: | Hemagglutinin in H3N2 influenza viruses | | Authors: | Fujii, Y., Sumida, T. | | Deposition date: | 2023-11-21 |
|
| PDBID: | 8x6q | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of OsHSL1 L204F/F298L/I335F complexed with 2-acetyl-cyclohexane-2,4-dione | | Authors: | Lin, H.-Y., Dong, J., Yang, G.-F. | | Deposition date: | 2023-11-21 |
|
| PDBID: | 8r64 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-20 |
|
| PDBID: | 8v1n | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of tau filaments made from jR2R3-P301L peptides induced with heparin | | Authors: | Vigers, M., Han, S. | | Deposition date: | 2023-11-20 |
|
| PDBID: | 8v18 | | Status: | HPUB -- hold until publication | | Title: | RNA polymerase II elongation complex with 8-oxoguanine with bound AMPCPP | | Authors: | Oh, J., Wang, D. | | Deposition date: | 2023-11-20 |
|
| PDBID: | 8v19 | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | RNA polymerase II elongation complex with Syn conformation 8-oxoguanine with AMP added | | Authors: | Oh, J., Wang, D. | | Deposition date: | 2023-11-20 |
|
| PDBID: | 8v1a | | Status: | HPUB -- hold until publication | | Title: | RNA polymerase II elongation complex with 8-oxoguanine and ATP in two different conformation: 8OG (syn)-ATP (A site) and 8OG (anti)-ATP (E site) | | Authors: | Oh, J., Wang, D. | | Deposition date: | 2023-11-20 |
|
| PDBID: | 8v1b | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-20 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMLEAASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQCGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKHYGPMEEPLVIEKDLPHYF
|
|
| PDBID: | 8v1c | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of GPX4-R152H in presence of DEL-I3 | | Authors: | Forouhar, F., Liu, H., Stockwell, B.R. | | Deposition date: | 2023-11-20 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMLEAASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQ(OCS)GKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKHYGPMEEPLVIEKDLPHYF
|
|
| PDBID: | 8v1d | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of GPX4-R152H in presence of DEL-I25 | | Authors: | Forouhar, F., Liu, H., Stockwell, B.R. | | Deposition date: | 2023-11-20 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMLEAASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQ(OCS)GKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKHYGPMEEPLVIEKDLPHYF
|
|
| PDBID: | 8v1m | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-11-20 |
|
| PDBID: | 8v1e | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-20 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMLEAASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQCGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKHYGPMEEPLVIEKDLPHYF
|
|
