| PDBID: | 9bvz | | Status: | HOLD -- hold until a certain date | | Title: | SARS-CoV-2 main protease bound to inhibitor AR-A-135 | | Authors: | Liu, W.R., Blankenship, L.R. | | Deposition date: | 2024-05-20 | | Release date: | 2025-05-20 |
|
| PDBID: | 9bw2 | | Status: | HPUB -- hold until publication | | Title: | Neutron Structure of Reduced Tyr34Phe MnSOD | | Authors: | Azadmanesh, J., Slobodnik, K., Struble, L.R., Cone, E.A., Dasgupta, M., Lutz, W.E., Kumar, S., Natarajan, A., Coates, L., Weiss, K.L., Myles, D.A.A., Kroll, T., Borgstahl, G.E.O. | | Deposition date: | 2024-05-20 | | Sequence: | >Entity 1
MKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAFVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
|
|
| PDBID: | 9bw3 | | Status: | HPUB -- hold until publication | | Title: | Consensus model for preturnover condition of Bacillus subtilis ribonucleotide reductase complex | | Authors: | Xu, D., Thomas, W.C., Burnim, A.A., Ando, N. | | Deposition date: | 2024-05-20 |
|
| PDBID: | 9bv8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-20 |
|
| PDBID: | 9bw4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-20 |
|
| PDBID: | 8zlf | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of DH domain of FYVE Domain containing protein(FP10) from Entamoeba histolytica | | Authors: | Gautam, A.K., Umarao, P., Gourinath, S. | | Deposition date: | 2024-05-19 |
|
| PDBID: | 9bv4 | | Status: | HPUB -- hold until publication | | Title: | NMR Solution Structure of Excelsatoxin A in DPC micelles | | Authors: | Saipriyaa, P.V., Chin, Y.K., Mehdi, M. | | Deposition date: | 2024-05-19 |
|
| PDBID: | 9bv1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-19 |
|
| PDBID: | 9bv2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-19 |
|
| PDBID: | 9bv3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-19 |
|
| PDBID: | 9fed | | Status: | HPUB -- hold until publication | | Title: | Single-chain chimeric protein mimicking the interaction between HR1 and HR2 in HIV gp41 | | Authors: | Camara-Artigas, A., Gavira, J.A., Conejero-Lara, F., Polo-Megias, D. | | Deposition date: | 2024-05-18 |
|
| PDBID: | 8zlb | | Status: | HPUB -- hold until publication | | Title: | EB bound state of hPAC | | Authors: | Su, N., Chen, X. | | Deposition date: | 2024-05-18 |
|
| PDBID: | 8zlc | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Ankyrin Repeat Protein from Plasmodium falciparum | | Authors: | Kumari, P., Gautam, A.K., Gourinath, S., Malhotra, P. | | Deposition date: | 2024-05-18 |
|
| PDBID: | 9fe2 | | Status: | HPUB -- hold until publication | | Title: | Crystallographic structure of AcrB V612W with bound minocycline | | Authors: | Lazarova, M., Pos, K.M. | | Deposition date: | 2024-05-17 |
|
| PDBID: | 9fe3 | | Status: | HPUB -- hold until publication | | Title: | Crystallographic structure of AcrB V612W | | Authors: | Lazarova, M., Pos, K.M. | | Deposition date: | 2024-05-17 |
|
| PDBID: | 9fe4 | | Status: | HPUB -- hold until publication | | Title: | Crystallographic structure of AcrB V612F | | Authors: | Lazarova, M., Diederichs, K., Pos, K.M. | | Deposition date: | 2024-05-17 |
|
| PDBID: | 9fdt | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human Sirt2 in complex with a pyrazole-based fragment inhibitor | | Authors: | Friedrich, F., Einsle, O., Jung, M. | | Deposition date: | 2024-05-17 |
|
| PDBID: | 9fdz | | Status: | HPUB -- hold until publication | | Title: | Single particle cryo-EM structure of the multidrug efflux pump OqxB from Klebsiella pneumoniae | | Authors: | Lazarova, M., Frangakis, A., Pos, K.M. | | Deposition date: | 2024-05-17 |
|
| PDBID: | 9fdp | | Status: | HPUB -- hold until publication | | Title: | Single particle cryo-EM structure of the AcrB V612W monomer in the O state | | Authors: | Lazarova, M., Boernsen, C., Frangakis, A., Pos, K.M. | | Deposition date: | 2024-05-17 |
|
| PDBID: | 9fdq | | Status: | HPUB -- hold until publication | | Title: | Single particle cryo-EM structure of the AcrB V612F monomer in the O state | | Authors: | Lazarova, M., Frangakis, A., Pos, K.M. | | Deposition date: | 2024-05-17 |
|
| PDBID: | 9fdl | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-17 |
|
| PDBID: | 9fdu | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human Sirt2 in complex with a pyridine-3-carbothioamide-based fragment inhibitor | | Authors: | Friedrich, F., Einsle, O., Jung, M. | | Deposition date: | 2024-05-17 |
|
| PDBID: | 9fdr | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human Sirt2 in apo form with opened selectivity pocket | | Authors: | Friedrich, F., Einsle, O., Jung, M. | | Deposition date: | 2024-05-17 |
|
| PDBID: | 9fdx | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human Sirt2 in complex with the peptide-based inhibitor KT9 | | Authors: | Friedrich, F., Schutkowski, M., Einsle, O., Jung, M. | | Deposition date: | 2024-05-17 |
|
| PDBID: | 9fdy | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-17 |
|
