| PDBID: | 9nwo | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-03-24 |
|
| PDBID: | 9nwp | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-24 |
|
| PDBID: | 9nwq | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-03-24 |
|
| PDBID: | 9nws | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-24 |
|
| PDBID: | 9nwt | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of DDB1dB:CRBN:mezigdomide:SALL4(392-449;G416A) | | Authors: | Park, J., Hunkeler, M., Roy Burman, S.S., Fischer, E.S. | | Deposition date: | 2025-03-24 |
|
| PDBID: | 9nww | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Single-particle cryo-EM structure of the first variant of mobilized colistin resistance (MCR-1) in its ligand-bound state | | Authors: | Zinkle, A.P., Bunuro-Batista, M., Herrera, C.M., Erramilli, S.K., Kloss, B., Ashraf, K.U., Nosol, K., Zhang, G., Cater, R.J., Marty, M.T., Kossiakoff, A.A., Trent, M.S., Nygaard, R., Stansfeld, P.J., Mancia, F. | | Deposition date: | 2025-03-24 |
|
| PDBID: | 9nwu | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of a high affinity Lv-Hv tetrabody for the erythropoietin receptor | | Authors: | Singer, A.U., Bruce, H.A., Yang, N., Blazer, L.L., Adams, J.J., Sidhu, S.S. | | Deposition date: | 2025-03-24 | | Sequence: | >Entity 1
DIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYSASSLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQSSYSLITFGQGTKVEIKGGGGGEVQLVESGGGLVQPGGSLRLSCAASGFNLRSYYMHWVRQAPGKGLEWVASISPYYSYTYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARHGYGAMDYWGQGTLVTVSS
|
|
| PDBID: | 9nwx | | Status: | HPUB -- hold until publication | | Title: | Discovery of a Small Molecule ITK and Pan-TRK Kinase Inhibitor (PF-07245303) for the Potential Topical Treatment of Atopic Dermatitis | | Authors: | Liu, S. | | Deposition date: | 2025-03-24 |
|
| PDBID: | 9nwr | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-24 |
|
| PDBID: | 9nwv | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-24 |
|
| PDBID: | 9qn0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-24 |
|
| PDBID: | 9qmt | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-24 |
|
| PDBID: | 9qmu | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-24 |
|
| PDBID: | 9qmv | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-24 |
|
| PDBID: | 9qmw | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-24 |
|
| PDBID: | 9qmx | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-24 |
|
| PDBID: | 9qmy | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-24 |
|
| PDBID: | 9qn5 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human SUMO E1 with small unit cell parameters in the P1 21 1 space group. | | Authors: | Viloria, M., Francois, R.M.M., Didierjean, C. | | Deposition date: | 2025-03-24 |
|
| PDBID: | 9qms | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | DNA-PK bound to 153 bp H2AX nucleosome with ATPyS | | Authors: | Hall, C., Chaplin, A.K. | | Deposition date: | 2025-03-24 |
|
| PDBID: | 9qmq | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-24 |
|
| PDBID: | 9qmo | | Status: | HPUB -- hold until publication | | Title: | PLK1 PBD apo protein at 1.6A | | Authors: | Ren, L., Gasper, R., Vetter, I., Musacchio, A. | | Deposition date: | 2025-03-24 |
|
| PDBID: | 9qne | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-24 |
|
| PDBID: | 9qn8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-24 |
|
| PDBID: | 9qna | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-24 |
|
| PDBID: | 9qnb | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-24 |
|
