| PDBID: | 8r89 | | Status: | HPUB -- hold until publication | | Title: | Structure of peptide CpRE12 bound to DPC micelle | | Authors: | Kornilov, F., Taldaev, A., Bashkirov, P., Bocharov, E. | | Deposition date: | 2023-11-28 |
|
| PDBID: | 8r84 | | Status: | HPUB -- hold until publication | | Title: | pentameric IgMFc-AIM complex focused refinement | | Authors: | Chen, Q., Arai, S., Miyazaki, T., Rosenthal, P. | | Deposition date: | 2023-11-28 |
|
| PDBID: | 8r83 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | pentameric IgMFc-AIM complex global refinement | | Authors: | Chen, Q., Arai, S., Miyazaki, T., Rosenthal, P. | | Deposition date: | 2023-11-28 |
|
| PDBID: | 8r8b | | Status: | HPUB -- hold until publication | | Title: | Wnt binding to COPalpha and COPBeta2 directs secretion on extracellular vesicles | | Authors: | Gurriaran-Rodriguez, U., Datzkiw, D., Radusky, L.G., Fisher, F., Xiao, F., Ming, H., De Repentigny, Y., Kothary, R., Serrano, L., Rojas, A.L., Hierro, A., Rudnicki, M.A. | | Deposition date: | 2023-11-28 |
|
| PDBID: | 8r87 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the Sars-Cov2 S trimer without RBDs | | Authors: | Effantin, G. | | Deposition date: | 2023-11-28 |
|
| PDBID: | 8v3h | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-28 |
|
| PDBID: | 8v3v | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-28 |
|
| PDBID: | 8v3i | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-28 |
|
| PDBID: | 8v4b | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | NMR structure of a synthetic analogue of Ramoplanin A2 | | Authors: | Swarbrick, J.D., Marschall, E.A., Cryle, M.J., Tailhades, J. | | Deposition date: | 2023-11-28 |
|
| PDBID: | 8v3u | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-28 |
|
| PDBID: | 8v3j | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-28 |
|
| PDBID: | 8v42 | | Status: | HPUB -- hold until publication | | Title: | Structure of Human Vaccinia-related Kinase 1 (VRK1) Bound to ACH000400 | | Authors: | Counago, R.M., de Souza, G.P., Azevedo, A., Guimaraes, C., Mascarello, A., Gama, F., Ferreira, M., Arruda, P. | | Deposition date: | 2023-11-28 | | Sequence: | >Entity 1
SMRVKAAQAGRQSSAKRHLAEQFAVGEIITDMAAAAWKVGLPIGQGGFGCIYLADMNSSESVGSDAPCVVKVEPSDNGPLFTELKFYQRAAKPEQIQKWIRTRKLKYLGVPKYWGSGLHDKNGKSYRFMIMDRFGSDLQKIYEANAKRFSRKTVLQLSLRILDILEYIHEHEYVHGDIKASNLLLNYKNPDQVYLVDYGLAYRYCPEGVHKAYAADPKRCHDGTIEFTSIDAHNGVAPSRRGDLEILGYCMIQWLTGHLPWEDNLKDPKYVRDSKIRYRENIASLMDKCFPAANAPGEIAKYMETVKLLDYTEKPLYENLRDILLQGLKAIGSKDDGKLDLSVVENGGLKAKTITKKRAAEIEE
|
|
| PDBID: | 8x8u | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of F.occidentalis GABARAP | | Authors: | Zhang, S.Q., Luo, X., Wu, Z.L., Zhao, K.H., Li, X.Y. | | Deposition date: | 2023-11-28 |
|
| PDBID: | 8x8d | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Mycobacterium tuberculosis transcription initiation complex with four GlnR and two PhoP molecules | | Authors: | Lin, W., Shi, J. | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8x8f | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of lipoxygenase from Enhygromyxa salina | | Authors: | Kim, J.W., Seo, P.W., Kim, J.S. | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8x8k | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8x8h | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-11-27 | | Release date: | 2024-11-27 |
|
| PDBID: | 8x8o | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8r7r | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8r7z | | Status: | HPUB -- hold until publication | | Title: | transcription factor BARHL2 homodimer with spacing four bp | | Authors: | Morgunova, E., Popov, A., Yin, Y., Taipale, J. | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8r82 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8r81 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8r7w | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8r7x | | Status: | HPUB -- hold until publication | | Title: | Kras G12D in complex with compound 4 | | Authors: | Kessler, D., Zak, K.M. | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8r7s | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
