| PDBID: | 8yeb | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of L-ribulose 3-epimerase from Arthrobacter globiformis M30 | | Authors: | Watanabe, M., Nakamich, Y., Mine, S. | | Deposition date: | 2024-02-22 |
|
| PDBID: | 8yef | | Status: | HPUB -- hold until publication | | Title: | HPV6 L1 pentamer in complex with Fab F5-77 | | Authors: | Wang, X., Fu, W. | | Deposition date: | 2024-02-22 |
|
| PDBID: | 8yeg | | Status: | HPUB -- hold until publication | | Title: | HPV11 L1 pentamer in complex with Fab F5-187 | | Authors: | Wang, X., Fu, W. | | Deposition date: | 2024-02-22 |
|
| PDBID: | 8yeh | | Status: | HPUB -- hold until publication | | Title: | HPV16 L1 pentamer in complex with Fab F5-196 | | Authors: | Wang, X., Fu, W. | | Deposition date: | 2024-02-22 |
|
| PDBID: | 8yei | | Status: | HPUB -- hold until publication | | Title: | HPV18 L1 pentamer in complex with Fab F5-203 | | Authors: | Wang, X., Fu, W. | | Deposition date: | 2024-02-22 |
|
| PDBID: | 8yec | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of L-ribulose 3-epimerase in complex with D-allulose | | Authors: | Watanabe, M., Nakamichi, Y., Mine, S. | | Deposition date: | 2024-02-22 |
|
| PDBID: | 8ye8 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of mouse BAHCC1 TTD domain in complex with H4K20me1 peptide | | Authors: | Zhang, Z.-M., Song, J. | | Deposition date: | 2024-02-22 |
|
| PDBID: | 8yem | | Status: | HPUB -- hold until publication | | Title: | Tubulin-RB3_SLD-TTL in complex with compound 9 | | Authors: | Wu, C.Y., Wang, Y.X. | | Deposition date: | 2024-02-22 |
|
| PDBID: | 8s4d | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-02-21 |
|
| PDBID: | 8s4l | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-21 |
|
| PDBID: | 8s4m | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Mycobacterium tuberculosis cytochrome P450 CYP125 in complex with an inhibitor | | Authors: | Snee, M., Kavanagh, M., Levy, C. | | Deposition date: | 2024-02-21 |
|
| PDBID: | 8s42 | | Status: | HPUB -- hold until publication | | Title: | Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) and compound 80 (1124898) | | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | | Deposition date: | 2024-02-21 |
|
| PDBID: | 8s4f | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-21 | | Sequence: | >Entity 1
MSPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
|
|
| PDBID: | 8s4n | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-21 |
|
| PDBID: | 8s4i | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-21 |
|
| PDBID: | 8s43 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-02-21 |
|
| PDBID: | 8s44 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-21 |
|
| PDBID: | 8s4o | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-21 |
|
| PDBID: | 8s4e | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-21 |
|
| PDBID: | 8w2y | | Status: | HPUB -- hold until publication | | Title: | Structure and interactions of HIV-1 gp41 CHR-NHR reverse hairpin constructs reveal molecular determinants of antiviral activity | | Authors: | McAndrew, R.P., Ralston, C.Y., Gochin, M. | | Deposition date: | 2024-02-21 |
|
| PDBID: | 8w2z | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-21 |
|
| PDBID: | 8w36 | | Status: | HPUB -- hold until publication | | Title: | rabbit actin in the absence of potassium | | Authors: | Volkmann, N. | | Deposition date: | 2024-02-21 |
|
| PDBID: | 8w32 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-21 |
|
| PDBID: | 8w2u | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of human tankyrase 2 SAM-PARP filament -apo state (consensus map). | | Authors: | Malone, B.F., Zimmerman, J.L., Dow, L.E., Hite, R.K. | | Deposition date: | 2024-02-21 |
|
| PDBID: | 8w2t | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of human tankyrase 2 SAM-PARP filament - apo state (focused refinement map). | | Authors: | Malone, B.F., Zimmerman, J.L., Dow, L.E., Hite, R.K. | | Deposition date: | 2024-02-21 |
|
