| PDBID: | 8r7v | | Status: | HPUB -- hold until publication | | Title: | MutSbeta bound to compound CHDI-00898647 in the canonical DNA-mismatch bound form | | Authors: | Haque, T., Brace, G., Felsenfeld, D., Tilack, K., Schaertl, S., Ballantyne, G., Maillard, M., Iyer, R., Prasad, B., Thomsen, M., Wilkionson, H., Plotnikov, N., Ritzefeld, M. | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8r7t | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8r7u | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8v3e | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8v39 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8v36 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8v37 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8v3f | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8v3g | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8v3a | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8v35 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8x89 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Streptococcus pneumoniae fabG | | Authors: | Xu, K.M. | | Deposition date: | 2023-11-27 | | Sequence: | >Entity 1
MKLEHKNIFITGSSRGIGLAIAHKFAQAGANIVLNSRGAISEELLAEFSNYGIKVVPISGDVSDFADAKRMIDQAIAELGSVDVLVNNAGITQDTLMLKMTEADFEKVLKVNLTGAFNMTQSVLKPMMKAREGAIINMSSVVGLMGNIGQANYAASKAGLIGFTKSVAREVASRNIRVNVIAPGMIESDMTAILSDKIKEATLAQIPMKEFGQAEQVADLTVFLAGQDYLTGQVIAIDGGLSM
|
|
| PDBID: | 8x8m | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8x8e | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of Mycobacterium tuberculosis transcription activation complex with two PhoP molecules | | Authors: | Lin, W., Shi, J. | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8x8c | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8x86 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8x8a | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8x8b | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8x8i | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8x8j | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8r7n | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-11-26 |
|
| PDBID: | 8v32 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-26 |
|
| PDBID: | 8x7v | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-11-26 | | Release date: | 2024-11-26 |
|
| PDBID: | 8x7w | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-11-26 | | Release date: | 2024-11-26 |
|
| PDBID: | 8r7j | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-11-25 | | Release date: | 2024-11-25 |
|
