| PDBID: | 8vbx | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-12 |
|
| PDBID: | 8vbh | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Kinetic intermediate states of HIV-1 RT DNA synthesis captured by cryo-EM | | Authors: | Vergara, S., Zhou, X., Santiago, U., Conway, J.F., Sluis-Cremer, N., Calero, G. | | Deposition date: | 2023-12-12 |
|
| PDBID: | 8vbc | | Status: | HPUB -- hold until publication | | Title: | Kinetic intermediate states of HIV-1 RT DNA synthesis captured by cryo-EM | | Authors: | Vergara, S., Zhou, X., Santiago, U., Conway, J.F., Sluis-Cremer, N., Calero, G. | | Deposition date: | 2023-12-12 |
|
| PDBID: | 8vbf | | Status: | HPUB -- hold until publication | | Title: | Kinetic intermediate states of HIV-1 RT DNA synthesis captured by cryo-EM | | Authors: | Vergara, S., Zhou, X., Santiago, U., Conway, J.F., Sluis-Cremer, N., Calero, G. | | Deposition date: | 2023-12-12 |
|
| PDBID: | 8xeh | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of HEPN-MNT complex | | Authors: | Jin, C., Jeon, C., Kim, D.H., Lee, B.J. | | Deposition date: | 2023-12-12 |
|
| PDBID: | 8xei | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of integrin ITGAV/ITGB3 complex, conformation 1 | | Authors: | Xi, Z. | | Deposition date: | 2023-12-12 |
|
| PDBID: | 8xek | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of integrin ITGAV/ITGB3 complex, conformation 2 | | Authors: | Xi, Z. | | Deposition date: | 2023-12-12 |
|
| PDBID: | 8xel | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of integrin ITGAV/ITGB3 complex, conformation 3 | | Authors: | Xi, Z. | | Deposition date: | 2023-12-12 |
|
| PDBID: | 8xen | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of integrin ITGAV/ITGB3 complex, conformation 4 | | Authors: | Xi, Z. | | Deposition date: | 2023-12-12 |
|
| PDBID: | 8xdx | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8xdl | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8xee | | Status: | HPUB -- hold until publication | | Title: | Human DNMT3B mutant-R823G | | Authors: | Cho, C.-C., Yuan, H.S. | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8xed | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Mycobacterium tuberculosis transcription activation complex with unphosphated PhoP | | Authors: | Lin, W., Shi, J. | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8rek | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8reg | | Status: | HPUB -- hold until publication | | Title: | Lysozyme measured via serial crystallography from a kapton HARE-chip (50 micron) | | Authors: | Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., Sung, S., von Stetten, D., Mehrabi, P., Schulz, E.C. | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8rel | | Status: | HPUB -- hold until publication | | Title: | Fab of an anti-PvAMA1 monoclonal antibody | | Authors: | Bentley, G.A., Saul, F.A., Vulliez-LeNormand, B. | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8reh | | Status: | HPUB -- hold until publication | | Title: | Lysozyme measured via serial crystallography from a kapton HARE-chip (125 micron) | | Authors: | Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., Sung, S., von Stetten, D., Mehrabi, P., Schulz, E.C. | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8rei | | Status: | HPUB -- hold until publication | | Title: | CTX-M-14 measured via serial crystallography from a silicon HARE-chip. | | Authors: | Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., Sung, S., von Stetten, D., Mehrabi, P., Schulz, E.C. | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8rej | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of PPAR gamma Ligand Binding Domain in complex with the ligand LBB78 | | Authors: | Capelli, D., Montanari, R. | | Deposition date: | 2023-12-11 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMAEISSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY
|
|
| PDBID: | 8rem | | Status: | HPUB -- hold until publication | | Title: | CTX-M-14 measured via serial crystallography from a kapton HARE-chip (50 micron) | | Authors: | Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., Sung, S., von Stetten, D., Mehrabi, P., Schulz, E.C. | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8va6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8vad | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8va5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8vau | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8vav | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-11 |
|
