| PDBID: | 8yqn | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-03-19 | | Release date: | 2025-03-19 |
|
| PDBID: | 8yqf | | Status: | HPUB -- hold until publication | | Title: | Structure of PsSIR2 tetradecamer | | Authors: | Yu, G., Liao, F., Li, X., Li, Z., Zhang, H. | | Deposition date: | 2024-03-19 |
|
| PDBID: | 8yqd | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human transthyretin variant A97S in complex with Tafamidis | | Authors: | Tzeng, S.R., Huang, C.H., Wang, Y.S., Hsieh, M.F. | | Deposition date: | 2024-03-19 |
|
| PDBID: | 8yq3 | | Status: | HPUB -- hold until publication | | Title: | Structure of cyclohexanone monooxygenase mutant from Acinetobacter calcoaceticus | | Authors: | Qiang, G., Zheng, Y.C., Feng, L., Yu, H.L. | | Deposition date: | 2024-03-19 |
|
| PDBID: | 9b3k | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-19 |
|
| PDBID: | 9b3e | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-19 |
|
| PDBID: | 9b3l | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-19 |
|
| PDBID: | 9b3o | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-19 |
|
| PDBID: | 9b3h | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-19 |
|
| PDBID: | 9b3j | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-03-19 |
|
| PDBID: | 9b3g | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-03-19 |
|
| PDBID: | 9b3f | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-19 |
|
| PDBID: | 9b3n | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-03-19 |
|
| PDBID: | 9b3m | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-19 |
|
| PDBID: | 9b31 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-18 |
|
| PDBID: | 9b32 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-18 |
|
| PDBID: | 9b3b | | Status: | HPUB -- hold until publication | | Title: | Structure of TDP1 complexed with compound IB09 | | Authors: | Lountos, G.T., Zhao, X.Z., Barakat, I., Wang, W., Agama, K., Al Mahmud, M.R., Pommier, Y., Burke, T.R. | | Deposition date: | 2024-03-18 |
|
| PDBID: | 9b3c | | Status: | HPUB -- hold until publication | | Title: | type 2 KD-mxyl filament of miniature tau macrocycle derived from 4R tauopathic fold | | Authors: | Xu, X., Angera, J.I., Rajewski, H.B., Jiang, W., Del Valle, R.J. | | Deposition date: | 2024-03-18 |
|
| PDBID: | 9ep9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-18 |
|
| PDBID: | 9epc | | Status: | PROC -- to be processed | | Title: | Cryo-EM structure of the Plastid-encoded RNA polymerase from Sinapis alba | | Authors: | Effantin, G., Blanvillain, R., Cobessi, D. | | Deposition date: | 2024-03-18 |
|
| PDBID: | 9ep8 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of ROCK2 in complex with a 8-(azaindolyl)-benzoazepinone inhibitor | | Authors: | Pala, D., Clark, D., Pioselli, B., Accetta, A., Rancati, F. | | Deposition date: | 2024-03-18 | | Sequence: | >Entity 1
GAAGDGAGASRQRKLEALIRDPRSPINVESLLDGLNSLVLDLDFPALRKNKNIDNFLNRYEKIVKKIRGLQMKAEDYDVVKVIGRGAFGEVQLVRHKASQKVYAMKLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWAKFYTAEVVLALDAIHSMGLIHRDVKPDNMLLDKHGHLKLADFGTCMKMDETGMVHCDTAVGTPDYISPEVLKSQGGDGFYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMDHKNSLCFPEDAEISKHAKNLICAFLTDREVRLGRNGVEEIRQHPFFKNDQWHWDNIRETAAPVVPELSSDIDSSNFDDIEDDKGDVETFPIPKAFVGNQLPFIGFTYYR
|
|
| PDBID: | 9epj | | Status: | HPUB -- hold until publication | | Title: | DtpAa Y389F 41 fs 10 microjoules XFEL Pulse Data Collection | | Authors: | Williams, L.J., Owen, R.L., Worrall, J.A.R., Hough, M.A. | | Deposition date: | 2024-03-18 |
|
| PDBID: | 9epe | | Status: | HPUB -- hold until publication | | Title: | 8fs pulse duration 10uJ pulse energy thaumatin | | Authors: | Owen, R.L., Hough, M.A., Worrall, J., Williams, L. | | Deposition date: | 2024-03-18 | | Sequence: | >Entity 1
ATFEIVNRCSYTVWAAASKGDAALDAGGRQLNSGESWTINVEPGTNGGKIWARTDCYFDDSGSGICKTGDCGGLLRCKRFGRPPTTLAEFSLNQYGKDYIDISNIKGFNVPMNFSPTTRGCRGVRCAADIVGQCPAKLKAPGGGCNDACTVFQTSEYCCTTGKCGPTEYSRFFKRLCPDAFSYVLDKPTTVTCPGSSNYRVTFCPTA
|
|
| PDBID: | 9epa | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-18 |
|
| PDBID: | 9epk | | Status: | HPUB -- hold until publication | | Title: | DtpAa Y389F 24 fs 100 microjoules XFEL Pulse Data Collection | | Authors: | Williams, L.J., Owen, R.L., Worrall, J.A.R., Hough, M.A. | | Deposition date: | 2024-03-18 |
|
