| PDBID: | 9o7o | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9o7m | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM Structure of YfdQ Reveals a Widespread Novel Family of Bacteriophage-Associated Proteins with Shell-Like Assemblies | | Authors: | Guzzo, C.R., Araujo, G.G., Merighi, D.G.S. | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9o7d | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-04-15 | | Release date: | 2026-04-15 |
|
| PDBID: | 9o7u | | Status: | HPUB -- hold until publication | | Title: | Structure Determination of Pedobacter sp. KP-2 PahZ1 | | Authors: | Wallen, J.R., Miller, J.M. | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9o7p | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human adenosine kinase (ADK) in complex with inhibitor BKI-1817 | | Authors: | Seattle Structural Genomics Center for Infectious Disease (SSGCID) | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9o7q | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human adenosine kinase (ADK) in complex with inhibitor BKI-1676 | | Authors: | Seattle Structural Genomics Center for Infectious Disease (SSGCID) | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9o7r | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human adenosine kinase (ADK) in complex with inhibitor BKI-1553 | | Authors: | Seattle Structural Genomics Center for Infectious Disease (SSGCID) | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9o8e | | Status: | HPUB -- hold until publication | | Title: | amyloid fibril of recombinant full-length 2N4R tau complexed with unfractionated mouse liver RNA and seeded by Alzheimer''s disease tau fibrils | | Authors: | Jiang, Y.X., Sawaya, M.R., Abskharon, R., Ge, P., Boyer, D.R., Eisenberg, D.S. | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9o7v | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of the RIb:C Heterodimer of PKA | | Authors: | Wu, J., Ilouz, R., Taylor, S.S. | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9o8a | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9o84 | | Status: | HPUB -- hold until publication | | Title: | Structure of turkey hemoglobin A at 1.7 Angstrom resolution (tetragonal form) | | Authors: | Bingman, C.A., Yin, J., Smith, R.W., Richards, M.P. | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9o8h | | Status: | HPUB -- hold until publication | | Title: | amyloid fibril of recombinant full-length 2N4R tau complexed with mouse liver 18S ribosomal RNA | | Authors: | Jiang, Y.X., Sawaya, M.R., Abskharon, R., Ge, P., Boyer, D.R., Eisenberg, D.S. | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9o7j | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9o7l | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9o7f | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-04-15 | | Release date: | 2026-04-15 |
|
| PDBID: | 9o7g | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-04-15 | | Release date: | 2026-04-15 |
|
| PDBID: | 9o7h | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-04-15 | | Release date: | 2026-04-15 |
|
| PDBID: | 9o7i | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-04-15 | | Release date: | 2026-04-15 |
|
| PDBID: | 9o7n | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9o85 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9o7e | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-04-15 | | Release date: | 2026-04-15 |
|
| PDBID: | 9qwp | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9qwr | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9qwv | | Status: | HPUB -- hold until publication | | Title: | Trypanosoma cruzi enoyl-CoA hydratase | | Authors: | Brannigan, J.A., Dodson, E.J. | | Deposition date: | 2025-04-15 | | Sequence: | >Entity 1
MLRKSLFLLNSMDPIVKYAQKGAVVTLTLNRPKQLNALNAELTNALAEKLLKCDADPSVSVLIITGEGRSFVAGADIKAMANQTFVEFYKHNMLRGLDTIAAVRKPIIAAVNGFALGGGCELAMSCDIVVASEKAIFGQPEIKIGTIPGAGGTQRLTRLIGKSKAMEWILTGEQYTAEEAERAGLVSRVVRHEELLPTVSAMAEKIALNSPLAVSLAKDCINKALETTLAQGMAYEQRTFQATFATDDQKEGMAAFVEKRKPNFKNA
|
|
| PDBID: | 9qx7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-15 |
|
