| PDBID: | 9j0e | | Status: | HPUB -- hold until publication | | Title: | Catalyst-free photoinitiated intramolecular carbon-carbon coupling enables the efficient synthesis of pharmaceutically important biaryls | | Authors: | Yang, L., Qu, X.D. | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9j0s | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9j0q | | Status: | HPUB -- hold until publication | | Title: | Structure of mEos3.2 in the green fluorescent state | | Authors: | Zheng, S.P. | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9cye | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9cyf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9cyh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9cyj | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9cyd | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9cyk | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9cyn | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-02 | | Sequence: | >Entity 1
GSGSMELRSITVESWDNPAASAAYGWEVFTDKDTQQAQGAQPQAYQPVAQNAQSLREVKLIAGKPGDIKNVDAGTAKVLGVKFQFTYPGDNSVTIRPPRVPEYEVLRTKSYLDANNQRKVSKIYGVEFPGVSKAISVWV(YCM)GRGNEYNLEGWIEDWKGDTHILQFGSLDFIGWRPLTVGIPQGVPQDVNSYPQVKTIVFKQFKIRSRPDTSGETVYLFFDELRVLSDVFEVHFDGASIDFDDEDCKSKHKLDKMLKTK
|
|
| PDBID: | 9cyt | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9cyx | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9cyu | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9j0a | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9cyi | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9cyg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9cyv | | Status: | HPUB -- hold until publication | | Title: | Structure of the Thermococcus sibiricus NfnABC complex | | Authors: | Xiao, X., Li, H. | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9cyw | | Status: | HPUB -- hold until publication | | Title: | Structure of the NAD(H)-bound Thermococcus sibiricus NfnABC complex | | Authors: | Xiao, X., Li, H. | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9j0d | | Status: | HPUB -- hold until publication | | Title: | Apo structure of ketoreductase AsuC7 from Asukamycin polyketide Synthases | | Authors: | Dai, Y., Qu, X. | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9j08 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9j0c | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9gcg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9gcb | | Status: | HPUB -- hold until publication | | Title: | Structure of IsDUF4198 | | Authors: | Franco Cairo, J.P.L., Correa, T.L.R., Offen, W.A., Nairn, A., Walton, J., Davies, G.J., Walton, P.H. | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9gce | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9gc2 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Arabidopsis thaliana PSI-LHCI- a603-NH mutant | | Authors: | Capaldi, S., Chaves-Sanjuan, A., Bonnet, D.M.V., Bassi, R. | | Deposition date: | 2024-08-01 |
|
