| PDBID: | 8xeh | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of HEPN-MNT complex | | Authors: | Jin, C., Jeon, C., Kim, D.H., Lee, B.J. | | Deposition date: | 2023-12-12 |
|
| PDBID: | 8xei | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of integrin ITGAV/ITGB3 complex, conformation 1 | | Authors: | Xi, Z. | | Deposition date: | 2023-12-12 |
|
| PDBID: | 8xee | | Status: | HPUB -- hold until publication | | Title: | Human DNMT3B mutant-R823G | | Authors: | Cho, C.-C., Yuan, H.S. | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8xed | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Mycobacterium tuberculosis transcription activation complex with unphosphated PhoP | | Authors: | Lin, W., Shi, J. | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8xdm | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8xef | | Status: | HPUB -- hold until publication | | Title: | Cocktail GC2050-GC2225 | | Authors: | Feng, L.L. | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8rek | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8reg | | Status: | HPUB -- hold until publication | | Title: | Lysozyme measured via serial crystallography from a kapton HARE-chip (50 micron) | | Authors: | Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., Sung, S., von Stetten, D., Mehrabi, P., Schulz, E.C. | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8reh | | Status: | HPUB -- hold until publication | | Title: | Lysozyme measured via serial crystallography from a kapton HARE-chip (125 micron) | | Authors: | Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., Sung, S., von Stetten, D., Mehrabi, P., Schulz, E.C. | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8rei | | Status: | HPUB -- hold until publication | | Title: | CTX-M-14 measured via serial crystallography from a silicon HARE-chip. | | Authors: | Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., Sung, S., von Stetten, D., Mehrabi, P., Schulz, E.C. | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8rej | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of PPAR gamma Ligand Binding Domain in complex with the ligand LBB78 | | Authors: | Capelli, D., Montanari, R. | | Deposition date: | 2023-12-11 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMAEISSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY
|
|
| PDBID: | 8rem | | Status: | HPUB -- hold until publication | | Title: | CTX-M-14 measured via serial crystallography from a kapton HARE-chip (50 micron) | | Authors: | Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., Sung, S., von Stetten, D., Mehrabi, P., Schulz, E.C. | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8rel | | Status: | HPUB -- hold until publication | | Title: | Fab of an anti-PvAMA1 monoclonal antibody | | Authors: | Bentley, G.A., Saul, F.A., Vulliez-LeNormand, B. | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8va6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8vad | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8va5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8vau | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8vai | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8vb2 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8vb3 | | Status: | HPUB -- hold until publication | | Title: | Dienelactone hydrolase from Solimonas fluminis | | Authors: | Schnettler Fernandez, J.D.F., Campbell, E.C., Hollfelder, F. | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8vay | | Status: | HPUB -- hold until publication | | Title: | Structure of Stryphnus fortis peptide | | Authors: | Gunasekera, S., Daly, N.L. | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8vag | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8vak | | Status: | HPUB -- hold until publication | | Title: | E.coli PNPase in complex with double 8-oxoG RNA | | Authors: | Kim, W., Zhang, Y.J. | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8vaa | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8va4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-11 |
|
