| PDBID: | 9bae | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
| PDBID: | 9b9u | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | SARS CoV-2 full-length spike protein with His1271Lys substitution in the coatomer binding motif, 1RBD-up conformation | | Authors: | Singh, S., Hasan, S.S. | | Deposition date: | 2024-04-03 |
|
| PDBID: | 9b9s | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
| PDBID: | 9b9v | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
| PDBID: | 9bad | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
| PDBID: | 9ba1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
| PDBID: | 9b9p | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 | | Sequence: | >Entity 1
MTTVYYDQDVKTDALQGKKIAVVGYGSQGHAHAQNLKDNGYDVVIGIRPGRSFDKAKEDGFDVFPVAEAVKQADVIMVLLPDEIQGDVYKNEIEPNLEKHNALAFAHGFNIHFGVIQPPADVDVFLVAPKGPGHLVRRTFVEGSAVPSLFGIQQDASGQARNIALSYAKGIGATRAGVIETTFKEETETDLFGEQAVLCGGVSKLIQSGFETLVEAGYQPELAYFEVLHEMKLIVDLMYEGGMENVRYSISNTAEFGDYVSGPRVITPDVKENMKAVLTDIQNGNFSNRFIEDNKNGFKEFYKLREEQHGHQIEKVGRELREMMPFIKSKSIEKHHHHHH
|
|
| PDBID: | 9b9q | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
| PDBID: | 9b9x | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
| PDBID: | 9b9t | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the ternary complex of DCAF1 and WDR5 with PROTAC, OICR-40407 | | Authors: | Mabanglo, M.F., Hoffer, L., Al-awar, R., Vedadi, M. | | Deposition date: | 2024-04-03 |
|
| PDBID: | 9b9w | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the ternary complex of DCAF1 and WDR5 with PROTAC, OICR-40792 | | Authors: | Mabanglo, M.F., Hoffer, L., Al-awar, R., Vedadi, M. | | Deposition date: | 2024-04-03 |
|
| PDBID: | 9ba2 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the binary complex of DCAF1 and WDR5 | | Authors: | Mabanglo, M.F., Vedadi, M., Al-awar, R. | | Deposition date: | 2024-04-03 |
|
| PDBID: | 9ba3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
| PDBID: | 9ba8 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | O-GlcNAcase (OGA) inhibitor complex for the Treatment of Alzheimer''s Disease | | Authors: | Hendle, J. | | Deposition date: | 2024-04-03 |
|
| PDBID: | 9bab | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM of Hyper2 tube, ~27 nm diameter | | Authors: | Sonani, R.R., Miller, J.G., Conticello, V., Egelman, E.H. | | Deposition date: | 2024-04-03 | | Release date: | 2025-04-03 |
|
| PDBID: | 9ba6 | | Status: | HPUB -- hold until publication | | Title: | High-resolution crystal structure of Vibrio cholerae NFeoB in the apo form | | Authors: | Lee, M., Smith, A.T. | | Deposition date: | 2024-04-03 |
|
| PDBID: | 9bac | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM of Hyper2 tube, ~24 nm diameter | | Authors: | Sonani, R.R., Miller, J.G., Conticello, V., Egelman, E.H. | | Deposition date: | 2024-04-03 | | Release date: | 2025-04-03 |
|
| PDBID: | 9ba7 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Vibrio cholerae N150T NFeoB variant with a single GDP molecule bound | | Authors: | Lee, M., Smith, A.T. | | Deposition date: | 2024-04-03 |
|
| PDBID: | 9ba9 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | O-GlcNAcase (OGA) inhibitor complex for the Treatment of Alzheimer''s Disease | | Authors: | Hendle, J. | | Deposition date: | 2024-04-03 |
|
| PDBID: | 9baa | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
| PDBID: | 9evu | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-02 |
|
| PDBID: | 9evv | | Status: | HOLD -- hold until a certain date | | Title: | His579Leu variant of L-arabinonate dehydratase co-crystallized with 2-oxobutyrate | | Authors: | Ren, Y., Rouvinen, J., Hakulinen, N. | | Deposition date: | 2024-04-02 | | Release date: | 2025-04-02 |
|
| PDBID: | 9evs | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Structure of the flowering plant mitoribosome with P-site tRNA | | Authors: | Waltz, F., Skaltsogiannis, V. | | Deposition date: | 2024-04-02 |
|
| PDBID: | 9evt | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Structure of the small subunit of the flowering plant mitoribosome with the maturation factor RsgA | | Authors: | Waltz, F., Skaltsogiannis, V. | | Deposition date: | 2024-04-02 |
|
| PDBID: | 9evw | | Status: | HPUB -- hold until publication | | Title: | Avian reovirus nonstructural protein sigmaNS | | Authors: | Kascakova, B., Tuma, R. | | Deposition date: | 2024-04-02 |
|
