PDBID: | 9etw | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-27 |
|
PDBID: | 9eu1 | Status: | HPUB -- hold until publication | Title: | GH29A alpha-L-fucosidase | Authors: | Yang, Y.Y., Zeuner, B., Morth, J.P. | Deposition date: | 2024-03-27 | Sequence: | >Entity 1 MQQKYQPTEANLKARSEFQDNKFGIFLHWGLYAMLATGEWTMTNNNLNYKEYAKLAGGFYPSKFDADKWVAAIKASGAKYICFTTRHHEGFSMFDTKYSDYNIVKATPFKRDVVKELADACAKHGIKLHFYYSHIDWYREDAPQGRTGRRTGRPNPKGDWKSYYQFMNNQLTELLTNYGPIGAIWFDGWWDQDINPDFDWELPEQYALIHRLQPACLVGNNHHQTPFAGEDIQIFERDLPGENTAGLSGQSVSHLPLETCETMNGMWGYKITDQNYKSTKTLIHYLVKAAGKDANLLMNIGPQPDGELPEVAVQRLKEVGEWMSKYGETIYGTRGGLVAPHDWGVTTQKGNKLYVHILNLQDKALFLPIVDKKVKKAVVFADKTPVRFTKNKEGIVLELAKVPTDVDYVVELTIDLEHHHHHH
|
|
PDBID: | 9etc | Status: | HPUB -- hold until publication | Title: | Crystal structure of recombinant chicken liver Bile Acid Binding Protein (cL-BABP) in complex with chenodeoxycholic acid | Authors: | Tassone, G., Pozzi, C. | Deposition date: | 2024-03-26 | Sequence: | >Entity 1 GSHMAFSGTWQVYAQENYEEFLKALALPEDLIKMARDIKPIVEIQQKGDDFVVTSKTPRQTVTNSFTLGKEADITTMDGKKLKCTVHLANGKLVTKSEKFSHEQEVKGNEMVETITFGGVTLIRRSKRV
|
|
PDBID: | 9eth | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-26 |
|
PDBID: | 8ytu | Status: | HPUB -- hold until publication | Title: | Mipa-PETase from Micromonospora pattaloongensis | Authors: | Hong, H., Seo, H., Park, J., Kim, K.-J. | Deposition date: | 2024-03-26 |
|
PDBID: | 8ytk | Status: | HPUB -- hold until publication | Title: | Crystal structure of human prolyl-tRNA synthetase in complex with inhibitor | Authors: | Luo, Z., Zhou, H. | Deposition date: | 2024-03-26 |
|
PDBID: | 8ytl | Status: | HPUB -- hold until publication | Title: | Human PPAR alpha ligand binding domain in complex with a 1H-pyrazolo[3,4-b]pyridine-derived compound | Authors: | Tachibana, K., Morie, T., Fukuda, S., Yuzuriha, T., Ishimoto, K., Nunomura, K., Lin, B., Miyachi, H., Oki, H., Kawahara, K., Meguro, K., Nakagawa, S., Tsujikawa, K., Akai, S., Doi, T., Yoshida, T. | Deposition date: | 2024-03-26 |
|
PDBID: | 8ytz | Status: | HPUB -- hold until publication | Title: | The P185V variant of Kubu-PETase from Kutzneria buriramensis | Authors: | Park, J., Seo, H., Hong, H., Kim, K.-J. | Deposition date: | 2024-03-26 |
|
PDBID: | 8yty | Status: | HPUB -- hold until publication | Title: | The M12+P185V variant of Kubu-PETase from Kutzneria buriramensis | Authors: | Park, J., Seo, H., Hong, H., Kim, K.-J. | Deposition date: | 2024-03-26 |
|
PDBID: | 8yu4 | Status: | HPUB -- hold until publication | Title: | Structure of cyclohexanone monooxygenase mutant from Acinetobacter calcoaceticus | Authors: | Qiang, G., Zheng, Y.C., Feng, L., Yu, H.L. | Deposition date: | 2024-03-26 |
|
PDBID: | 8yu3 | Status: | PROC -- to be processed | Title: | NMR solution structure of the 2:1 complex of a platinum(II) compound bound to Myc1234 G-quadruplex | Authors: | Liu, W., Mao, Z.W. | Deposition date: | 2024-03-26 |
|
PDBID: | 8ytv | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-26 |
|
PDBID: | 8ytw | Status: | HPUB -- hold until publication | Title: | Kubu-PETase from Kutzneria buriramensis | Authors: | Park, J., Seo, H., Hong, H., Kim, K.-J. | Deposition date: | 2024-03-26 |
|
PDBID: | 8yu1 | Status: | HOLD -- hold until a certain date | Deposition date: | 2024-03-26 | Release date: | 2025-03-26 |
|
PDBID: | 8ytt | Status: | HPUB -- hold until publication | Title: | Structure of cyclohexanone monooxygenase mutant from Acinetobacter calcoaceticus | Authors: | Qiang, G., Zheng, Y.C., Feng, L., Yu, H.L. | Deposition date: | 2024-03-26 |
|
PDBID: | 8ytj | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of enterovirus A71 mature virion | Authors: | Jiang, Y., Huang, Y., Zhu, R., Zheng, Q., Li, S., Xia, N. | Deposition date: | 2024-03-26 |
|
PDBID: | 8ytm | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of actinomycin D and Echinomycin-d(ACGATGCT/AGCACGT) complex | Authors: | Wu, Y.S., Lee, Y.Y., Hou, M.H. | Deposition date: | 2024-03-26 |
|
PDBID: | 8yu0 | Status: | HPUB -- hold until publication | Title: | Structure of cyclohexanone monooxygenase mutant from Acinetobacter calcoaceticus | Authors: | Qiang, G., Zheng, Y.C., Feng, L., Yu, H.L. | Deposition date: | 2024-03-26 |
|
PDBID: | 8yu2 | Status: | HPUB -- hold until publication | Title: | Structure of cyclohexanone monooxygenase mutant from Acinetobacter calcoaceticus | Authors: | Qiang, G., Zheng, Y.C., Feng, L., Yu, H.L. | Deposition date: | 2024-03-26 |
|
PDBID: | 8yu7 | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of CXCR4 tetramer | Authors: | Liu, A., Liu, Y. | Deposition date: | 2024-03-26 |
|
PDBID: | 9b6y | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-26 |
|
PDBID: | 9b6u | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-26 |
|
PDBID: | 9b6z | Status: | AUTH -- processed, waiting for author review and approval | Title: | NMR solution structure of the 1:1 complex of a platinum(II) compound bound to Myc1234 G-quadruplex | Authors: | Liu, W., Mao, Z.W. | Deposition date: | 2024-03-26 |
|
PDBID: | 9b72 | Status: | HPUB -- hold until publication | Title: | Rec2 Domain from G. stearothermophilus Cas9 | Authors: | D''Ordine, A.M., Belato, H.B., Lisi, G.P., Jogl, G. | Deposition date: | 2024-03-26 |
|
PDBID: | 9b6v | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-26 |
|