| PDBID: | 9fqc | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of phosphoserine phosphatase (SerB) from Brucella melitensis in copmplex with O-Phosphoserine | | Authors: | Scaillet, T., Wouters, J. | | Deposition date: | 2024-06-15 |
|
| PDBID: | 8zxz | | Status: | HPUB -- hold until publication | | Title: | Complex I form respirasome closed state bound by proguanil (SC-ProgC) | | Authors: | Teng, F., He, Z.X., Hu, Y.Q., Xu, C.Y., Guo, R.Y., Zhou, L. | | Deposition date: | 2024-06-15 |
|
| PDBID: | 8zxu | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of N terminal deletion mutant of Staphylococcal atypical two-cysteine thiol peroxidase complexed with substrate analog | | Authors: | Shukla, M., Maji, S., Yadav, V.K., Bhattacharyya, S. | | Deposition date: | 2024-06-15 |
|
| PDBID: | 8zxs | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-06-15 | | Release date: | 2025-06-15 |
|
| PDBID: | 8zxt | | Status: | HPUB -- hold until publication | | Title: | sweet protein MNEI-Mut 6-3 | | Authors: | You, T.J., Liu, S. | | Deposition date: | 2024-06-15 |
|
| PDBID: | 8zxv | | Status: | HPUB -- hold until publication | | Title: | sweet protein MNEI-Mut 6-4 | | Authors: | You, T.J., Liu, S. | | Deposition date: | 2024-06-15 |
|
| PDBID: | 8zxx | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-15 |
|
| PDBID: | 8zxw | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-15 |
|
| PDBID: | 8zxy | | Status: | HPUB -- hold until publication | | Title: | sweet protein MNEI-Mut 6-2 | | Authors: | You, T.J., Liu, S. | | Deposition date: | 2024-06-15 |
|
| PDBID: | 9c9u | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-15 |
|
| PDBID: | 9c9t | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2024-06-15 |
|
| PDBID: | 9c9s | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2024-06-15 |
|
| PDBID: | 9fpx | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of DYRK1A in complex with Curcumin | | Authors: | Grygier, P., Pustelny, K., Czarna, A. | | Deposition date: | 2024-06-14 |
|
| PDBID: | 9fqb | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-14 |
|
| PDBID: | 9fq1 | | Status: | HPUB -- hold until publication | | Title: | Structure of the disease-causing mutant P20S of human KCTD1 | | Authors: | Balasco, N., Ruggiero, A., Smaldone, G., Esposito, L., Berisio, R., Vitagliano, L. | | Deposition date: | 2024-06-14 | | Sequence: | >Entity 1
MSRPLITRSPASPLNNQGISTPAQLTKSNAPVHIDVGGHMYTSSLATLTKYPESRIGRLFDGTEPIVLDSLKQHYFIDRDGQMFRYILNFLRTSKLLIPDDFKDYTLLYEEAKYFQLQPMLLEMERWKQDRETGRFSRPCECLVVRVAPDLGERITLSGDKSLIEEVFPEIGDVMCNSVNAGWNHDSTHVIRFPLNGYCHLNSVQVLERLQQRGFEIVGSCGGGVDSSQFSEYVLRRELRRTPRVPSVIRIKQEPLD
|
|
| PDBID: | 9fq4 | | Status: | HPUB -- hold until publication | | Title: | Glyceraldehyde 3-phosphate dehydrogenase A (GAPDHA) NADP holoenzyme, from Helicobacter pylori, with active site cysteine oxidised to sulfenic acid | | Authors: | Foster, S.P., Moody, P.C.E. | | Deposition date: | 2024-06-14 |
|
| PDBID: | 9fpy | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-06-14 |
|
| PDBID: | 9fq6 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-06-14 |
|
| PDBID: | 9fq5 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of phosphoserine phosphatase (SerB) from Brucella melitensis | | Authors: | Scaillet, T., Wouters, J. | | Deposition date: | 2024-06-14 |
|
| PDBID: | 9fq7 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Perkinsus marinus Respiratory supercomplex CII2CIII2CIV2 in c1 sate | | Authors: | Wu, F., Amunts, A. | | Deposition date: | 2024-06-14 |
|
| PDBID: | 9fq8 | | Status: | HPUB -- hold until publication | | Title: | Perkinsus marinus Respiratory complex CIV | | Authors: | Wu, F., Amunts, A. | | Deposition date: | 2024-06-14 |
|
| PDBID: | 9fq3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-14 |
|
| PDBID: | 8zxi | | Status: | HOLD -- hold until a certain date | | Title: | Peptide channel interactions in the truncated VhChiP nanopore | | Authors: | Sanram, S., Suginta, W., Robinson, R.C. | | Deposition date: | 2024-06-14 | | Release date: | 2025-06-14 |
|
| PDBID: | 8zxb | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-14 |
|
| PDBID: | 8zxd | | Status: | HPUB -- hold until publication | | Title: | the Planar Cell Polarity Core Protein Vangl1 | | Authors: | Zhang, F., Chen, S. | | Deposition date: | 2024-06-14 |
|
