| PDBID: | 9ja7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-24 |
|
| PDBID: | 9ja9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-24 |
|
| PDBID: | 9jak | | Status: | HPUB -- hold until publication | | Title: | P[28] rotavirus VP8* protein with LNFP-I | | Authors: | Zheng, Y., Yan, J. | | Deposition date: | 2024-08-24 |
|
| PDBID: | 9gk4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-23 |
|
| PDBID: | 9gk5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-23 |
|
| PDBID: | 9gk7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-23 |
|
| PDBID: | 9gkc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-23 |
|
| PDBID: | 9gk8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-23 |
|
| PDBID: | 9gk9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-23 |
|
| PDBID: | 9gka | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-23 |
|
| PDBID: | 9gkd | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-23 |
|
| PDBID: | 9gk1 | | Status: | HPUB -- hold until publication | | Title: | SSX structure of human cytochrome P450 3A4 at room temperature | | Authors: | Glerup, J., Branden, G., Uwangue, O. | | Deposition date: | 2024-08-23 |
|
| PDBID: | 9gjz | | Status: | HOLD -- hold until a certain date | | Title: | Ntaya methyltransferase (MTase) bound to AT-9010 (2''-methyl-2''-fluoro GTP) | | Authors: | Boura, E., Krejcova, K. | | Deposition date: | 2024-08-23 | | Release date: | 2024-10-18 |
|
| PDBID: | 9gk3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-23 |
|
| PDBID: | 9gkf | | Status: | HPUB -- hold until publication | | Title: | Amyloid Fibril of Heterogeneous nuclear ribonucleoprotein A1A induced by RNA binding | | Authors: | Frey, L., Riek, R.P., Arosio, P., Morelli, C. | | Deposition date: | 2024-08-23 |
|
| PDBID: | 9gjy | | Status: | HPUB -- hold until publication | | Title: | Bacillus licheniformis nitroreductase | | Authors: | Crennell, S.J., Danson, M.J., Emptage, C. | | Deposition date: | 2024-08-23 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMMTEQSKKQEILDAFQFRHATKEFDPDRKISDEDFQFILEAGRLSPSSVGLEPWQFVVVQNKELREKLRQVSWGAQGQLPTASHFVLLLGRTAKEMRRDSGYVADQLKHVKKMPEDIIENMLKEDGVLESFQDGDFHLYESDRAMFDWVSKQTYIALANMMTAAALIGIDSCPIEGFNYDKVHDILEKEGVLEDGRFDISVMAAFGYRVKEPRPKTRRALDQIVKWVE
|
|
| PDBID: | 9gjx | | Status: | HPUB -- hold until publication | | Title: | Bacillus licheniformis nitroreductase | | Authors: | Crennell, S.J., Danson, M.J., Emptage, C. | | Deposition date: | 2024-08-23 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMMTEQSKKQEILDAFQFRHATKEFDPDRKISDEDFQFILEAGRLSPSSVGLEPWQFVVVQNKELREKLRQVSWGAQGQLPTASHFVLLLGRTAKEMRRDSGYVADQLKHVKKMPEDIIENMLKEDGVLESFQDGDFHLYESDRAMFDWVSKQTYIALANMMTAAALIGIDSCPIEGFNYDKVHDILEKEGVLEDGRFDISVMAAFGYRVKEPRPKTRRALDQIVKWVE
|
|
| PDBID: | 9gk0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-23 |
|
| PDBID: | 9gkb | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-08-23 | | Release date: | 2025-08-23 |
|
| PDBID: | 9gk6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-23 |
|
| PDBID: | 9gke | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-23 |
|
| PDBID: | 9dbt | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-23 |
|
| PDBID: | 9db6 | | Status: | HPUB -- hold until publication | | Title: | Sialidase682 co-crystallized with inhibitor DANA | | Authors: | Young, M.A., Rees, S.D., Chang, G. | | Deposition date: | 2024-08-23 |
|
| PDBID: | 9dbx | | Status: | HOLD -- hold until a certain date | | Title: | Structure of AG11-2F01 Fab in complex with A/Solomon Islands/3/2006 (H1N1) influenza virus hemagglutinin | | Authors: | Mou, Z., Lei, R., Dai, X., Wu, N. | | Deposition date: | 2024-08-23 | | Release date: | 2025-08-23 |
|
| PDBID: | 9dbi | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-23 |
|
