| PDBID: | 8vbr | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-12 |
|
| PDBID: | 8vbp | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-12 |
|
| PDBID: | 8vbq | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-12 |
|
| PDBID: | 8vba | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-12 |
|
| PDBID: | 8vbb | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-12 |
|
| PDBID: | 8vbl | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-12 |
|
| PDBID: | 8vbj | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-12 |
|
| PDBID: | 8vbk | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-12 |
|
| PDBID: | 8xeh | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of HEPN-MNT complex | | Authors: | Jin, C., Jeon, C., Kim, D.H., Lee, B.J. | | Deposition date: | 2023-12-12 |
|
| PDBID: | 8xem | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of apo HEPN toxin | | Authors: | Jin, C., Jeon, C., Kim, D.H., Lee, B.J. | | Deposition date: | 2023-12-12 |
|
| PDBID: | 8xeo | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of MNT antitoxin | | Authors: | Jin, C., Jeon, C., Kim, D.H., Lee, B.J. | | Deposition date: | 2023-12-12 |
|
| PDBID: | 8xer | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of integrin ITGAV, ITGB3 and Cilengitide TFA complex, conformation 1 | | Authors: | Xi, Z. | | Deposition date: | 2023-12-12 |
|
| PDBID: | 8xdl | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8xeb | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of Mycobacterium tuberculosis transcription activation complex with four PhoP molecules | | Authors: | Lin, W., Shi, J. | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8xec | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of Mycobacterium tuberculosis transcription activation complex with two PhoP molecules | | Authors: | Lin, W., Shi, J. | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8xdm | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8xef | | Status: | HPUB -- hold until publication | | Title: | Cocktail GC2050-GC2225 | | Authors: | Feng, L.L. | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8rek | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8reg | | Status: | HPUB -- hold until publication | | Title: | Lysozyme measured via serial crystallography from a kapton HARE-chip (50 micron) | | Authors: | Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., Sung, S., von Stetten, D., Mehrabi, P., Schulz, E.C. | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8rel | | Status: | HPUB -- hold until publication | | Title: | Fab of an anti-PvAMA1 monoclonal antibody | | Authors: | Bentley, G.A., Saul, F.A., Vulliez-LeNormand, B. | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8reh | | Status: | HPUB -- hold until publication | | Title: | Lysozyme measured via serial crystallography from a kapton HARE-chip (125 micron) | | Authors: | Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., Sung, S., von Stetten, D., Mehrabi, P., Schulz, E.C. | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8rei | | Status: | HPUB -- hold until publication | | Title: | CTX-M-14 measured via serial crystallography from a silicon HARE-chip. | | Authors: | Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., Sung, S., von Stetten, D., Mehrabi, P., Schulz, E.C. | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8rej | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of PPAR gamma Ligand Binding Domain in complex with the ligand LBB78 | | Authors: | Capelli, D., Montanari, R. | | Deposition date: | 2023-12-11 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMAEISSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY
|
|
| PDBID: | 8rem | | Status: | HPUB -- hold until publication | | Title: | CTX-M-14 measured via serial crystallography from a kapton HARE-chip (50 micron) | | Authors: | Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., Sung, S., von Stetten, D., Mehrabi, P., Schulz, E.C. | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8va6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-11 |
|
