PDBID: | 8k1e | Status: | HPUB -- hold until publication | Deposition date: | 2023-07-11 | Release date: | 2025-01-11 |
|
PDBID: | 8k1x | Status: | HOLD -- hold until a certain date | Title: | Biochemical and structural characterization of a multifunctional cytochrome P450 SpcN in staurosporine biosynthesis | Authors: | Xiao, F., Dong, S., Feng, Y., Li, W. | Deposition date: | 2023-07-11 | Release date: | 2024-10-11 |
|
PDBID: | 8pq3 | Status: | HPUB -- hold until publication | Deposition date: | 2023-07-10 | Release date: | 2025-01-10 |
|
PDBID: | 8ppx | Status: | HPUB -- hold until publication | Title: | Influenza A/California/07/2009(H1N1) endonuclease in complex with flavonoid-like compound | Authors: | Radilova, K., Brynda, J. | Deposition date: | 2023-07-10 | Release date: | 2025-01-10 |
|
PDBID: | 8pq8 | Status: | HPUB -- hold until publication | Deposition date: | 2023-07-10 | Release date: | 2025-01-10 |
|
PDBID: | 8k0u | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-07-10 | Release date: | 2025-01-10 |
|
PDBID: | 8k0t | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-07-10 | Release date: | 2025-01-10 |
|
PDBID: | 8k0v | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-07-10 | Release date: | 2025-01-10 |
|
PDBID: | 8k0w | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-07-10 | Release date: | 2025-01-10 |
|
PDBID: | 8k18 | Status: | HOLD -- hold until a certain date | Title: | Neutralization antibody ZCP4C9 bound with SARS-CoV-2 Omicron BA.5 RBD | Authors: | Bingjie, T., Shangyu, D. | Deposition date: | 2023-07-10 | Release date: | 2025-01-22 |
|
PDBID: | 8k19 | Status: | HOLD -- hold until a certain date | Title: | Neutralization antibody ZCP3B4 bound with SARS-CoV-2 Omicron BA.5 RBD | Authors: | Tang, B., Dang, S. | Deposition date: | 2023-07-10 | Release date: | 2025-01-22 |
|
PDBID: | 8k0n | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-07-10 | Release date: | 2024-12-31 |
|
PDBID: | 8k0y | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-07-10 | Release date: | 2025-01-10 |
|
PDBID: | 8ppy | Status: | HPUB -- hold until publication | Deposition date: | 2023-07-10 | Release date: | 2025-01-10 |
|
PDBID: | 8tfd | Status: | HPUB -- hold until publication | Deposition date: | 2023-07-10 | Release date: | 2025-01-08 |
|
PDBID: | 8k0g | Status: | HPUB -- hold until publication | Deposition date: | 2023-07-09 | Release date: | 2025-01-09 |
|
PDBID: | 8k08 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-07-07 | Release date: | 2025-01-07 |
|
PDBID: | 8k09 | Status: | HPUB -- hold until publication | Deposition date: | 2023-07-07 | Release date: | 2025-01-07 |
|
PDBID: | 8tf5 | Status: | HPUB -- hold until publication | Deposition date: | 2023-07-07 | Release date: | 2025-01-07 |
|
PDBID: | 8tf6 | Status: | HPUB -- hold until publication | Title: | X-ray Crystal Structure Determination of Dihydromethanopterin Reductase A (DmrA) from Methylobacterium extorquens AM1 by Se-SAD Phasing in a F222 Crystal form at 2.70 Angstroms Resolution | Authors: | Axelrod, H.L., Rasche, M., Cascio, D., Arbing, M., Collazo, M.J., Potla, P.S., ? | Deposition date: | 2023-07-07 | Release date: | 2025-01-08 | Sequence: | >Entity 1 (MSE)IDVRCICAIGQRGQLGLNGHLPWEGNTDPLFVEDVTRFFALT(MSE)GHVLIAGPKTVASVPEFAFKDRTIDVIRSHEDPEAVLKRYPGRRIFVGGGIAVWNVYAKYIQHWDVTRLPYDGEADRWFDPAWLVGGPLRHHHHHH
|
|
PDBID: | 8tf0 | Status: | HPUB -- hold until publication | Deposition date: | 2023-07-07 | Release date: | 2025-01-15 |
|
PDBID: | 8tez | Status: | HPUB -- hold until publication | Title: | Crystal Structure of Pyridoxal Reductase (PDXI)in complex with NADPH | Authors: | Donkor, A.K., Safo, M.K., Musayev, F.N. | Deposition date: | 2023-07-07 | Release date: | 2024-08-01 |
|
PDBID: | 8tf1 | Status: | HPUB -- hold until publication | Title: | Crystal Structure of Pyridoxal Reductase (PDXI)in complex with NADPH and Pyridoxal | Authors: | Donkor, A.K., Safo, M.K., Musayev, F.N. | Deposition date: | 2023-07-07 | Release date: | 2024-08-01 |
|
PDBID: | 8jzp | Status: | HOLD -- hold until a certain date | Title: | Structure of mouse C5a-human C5aR1-Go complex | Authors: | Yadav, M.K., Yadav, R., Maharana, J., Sarma, P., Banerjee, R., Shukla, A.K., Gati, C. | Deposition date: | 2023-07-06 | Release date: | 2025-01-06 |
|
PDBID: | 8jzt | Status: | AUTH -- processed, waiting for author review and approval | Title: | The sigF and anti-sigma factor complex | Authors: | Chen, Y.J., Su, D. | Deposition date: | 2023-07-06 | Release date: | 2024-10-06 |
|