| PDBID: | 9qwp | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9qwr | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9qwv | | Status: | HPUB -- hold until publication | | Title: | Trypanosoma cruzi enoyl-CoA hydratase | | Authors: | Brannigan, J.A., Dodson, E.J. | | Deposition date: | 2025-04-15 | | Sequence: | >Entity 1
MLRKSLFLLNSMDPIVKYAQKGAVVTLTLNRPKQLNALNAELTNALAEKLLKCDADPSVSVLIITGEGRSFVAGADIKAMANQTFVEFYKHNMLRGLDTIAAVRKPIIAAVNGFALGGGCELAMSCDIVVASEKAIFGQPEIKIGTIPGAGGTQRLTRLIGKSKAMEWILTGEQYTAEEAERAGLVSRVVRHEELLPTVSAMAEKIALNSPLAVSLAKDCINKALETTLAQGMAYEQRTFQATFATDDQKEGMAAFVEKRKPNFKNA
|
|
| PDBID: | 9qx7 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9qwq | | Status: | PROC -- to be processed | | Title: | Human vault protein - committed conformation | | Authors: | Lapenta, F., Marechal, N., Durand, A., Aupic, A., Cassetta, A. | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9qx3 | | Status: | PROC -- to be processed | | Title: | E. coli beta-clamp in complex with designed circular peptide | | Authors: | Simonsen, S., Zhao, J., Soegaard, K., Olsen, J.G., Otterlei, M., Rogers, J.M., Kragelund, B.B. | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9qx8 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9qww | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of plant resistance protein NRC2 dimer bound to nematode effector SPRYSEC-15 | | Authors: | Selvaraj, M., Kamoun, S., Contreras, M. | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9qxj | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of Rysto resistosome in complex with PVY coat protein | | Authors: | Zhao, H., Lukoyanova, N., Selvaraj, M., Jones, J. | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9qx9 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9qwt | | Status: | PROC -- to be processed | | Title: | Mouse Ribosome RPS15 (uS19) P131S rotated-2 PRE state | | Authors: | Santo, P.E., Astier, A., Plisson-Chastang, C. | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9qxa | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9qxe | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9qwy | | Status: | PROC -- to be processed | | Title: | Crystal structure of an NtA622L variant in complex with NADPH and Trigonelline | | Authors: | Mokos, D., Leitner, D., Daniel, B. | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9qxi | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9qxb | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9qxc | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9qxd | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9qx4 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Nostoc sp. 3335mg GT108 family enzyme purified in HEPES, with Bis-Tris propane and phosphate in the active site | | Authors: | Males, A., Ralton, J.E., Kaur, A., Butriss, K., Sobala, L.F., Sharma, M., Moroz, O.V., Williams, S.J., McConville, M.J., Davies, G.J. | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9qxh | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9qxk | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9qxf | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9qx6 | | Status: | PROC -- to be processed | | Title: | Crystal structure of RXR alpha LBD bound to a synthetic agonist FN537 and a coactivator fragment | | Authors: | Morozov, V., Merk, D., Nawa, F. | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9qws | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9qwu | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-15 |
|
