| PDBID: | 9ol6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-12 |
|
| PDBID: | 9old | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of alpha-NPG-bound D59C MelBSt | | Authors: | Guan, L., Hariharan, P. | | Deposition date: | 2025-05-12 |
|
| PDBID: | 9olc | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of PPARg ligand-binding domain in complex with NCoR1 peptide and FTX-6746 | | Authors: | Setser, J.W., DeLaBarre, B. | | Deposition date: | 2025-05-12 |
|
| PDBID: | 9olb | | Status: | HPUB -- hold until publication | | Title: | Identification of ligands for E3 ligases using fragment-based methods | | Authors: | Phan, J., Fesik, S.W. | | Deposition date: | 2025-05-12 |
|
| PDBID: | 9oli | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the melibiose-bound melibiose transporter | | Authors: | Guan, L., Hariharan, P. | | Deposition date: | 2025-05-12 | | Release date: | 2026-05-12 |
|
| PDBID: | 9oln | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-12 |
|
| PDBID: | 9olo | | Status: | HPUB -- hold until publication | | Title: | 22bin20S complex (NSF-alphaSNAP-2:2 syntaxin-1a:SNAP-25), hydrolyzing, class 19 | | Authors: | White, K.I., Brunger, A.T. | | Deposition date: | 2025-05-12 |
|
| PDBID: | 9olp | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of a raffinose-bound D59C MelB | | Authors: | Guan, L., Hariharan, P. | | Deposition date: | 2025-05-12 | | Release date: | 2026-05-12 |
|
| PDBID: | 9olq | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-12 |
|
| PDBID: | 9olr | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of D59C MelB st bound with alpha-methyl galactoside (aMG) | | Authors: | Guan, L., Hariharan, P. | | Deposition date: | 2025-05-12 | | Release date: | 2026-05-12 |
|
| PDBID: | 9uwf | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-12 |
|
| PDBID: | 9uwi | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-12 |
|
| PDBID: | 9uwt | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of human galectin-10 produced by cell-free protein synthesis in complex with maltose | | Authors: | Kojima, M., Ueno, T., Abe, S., Hirata, K. | | Deposition date: | 2025-05-12 | | Release date: | 2026-05-12 |
|
| PDBID: | 9uwu | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of human galectin-10 produced by cell-free protein synthesis in complex with melezitose | | Authors: | Kojima, M., Ueno, T., Abe, S., Hirata, K. | | Deposition date: | 2025-05-12 | | Release date: | 2026-05-12 |
|
| PDBID: | 9r6i | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of PPARgamma in complex with the bisphenol derivative BPS4BE | | Authors: | Carivenc, C., Bourguet, W. | | Deposition date: | 2025-05-12 | | Sequence: | >Entity 1
GSHMQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY
|
|
| PDBID: | 9r6k | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of PPARgamma in complex with the bisphenol derivative BPPH | | Authors: | Carivenc, C., Bourguet, W. | | Deposition date: | 2025-05-12 | | Sequence: | >Entity 1
GSHMQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY
|
|
| PDBID: | 9r6h | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-12 |
|
| PDBID: | 9r6e | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-12 |
|
| PDBID: | 9r6f | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-12 |
|
| PDBID: | 9r6g | | Status: | HPUB -- hold until publication | | Title: | Map of neurofibromin homodimer lobe region. Post-processed by DeepEMhancer using combined half maps. | | Authors: | Shutian, S. | | Deposition date: | 2025-05-12 |
|
| PDBID: | 9r6j | | Status: | HPUB -- hold until publication | | Title: | Map of neurofibromin homotetramer with D2 symmetry (DeepEMhancer) | | Authors: | Shutian, S. | | Deposition date: | 2025-05-12 |
|
| PDBID: | 9uvt | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-11 |
|
| PDBID: | 9uvu | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-11 |
|
| PDBID: | 9uvv | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-11 |
|
| PDBID: | 9uvw | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-11 |
|
