| PDBID: | 9vf1 | | Status: | HPUB -- hold until publication | | Title: | Structure of the magnesium channel CorA from Mycobacteria smegmatis in the resting state | | Authors: | Chen, X., Li, M. | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9vez | | Status: | HPUB -- hold until publication | | Title: | Structure of the magnesium channel CorA from Mycobacteria smegmatis in the presence of 1 mM EDTA | | Authors: | Chen, X., Li, M. | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9vep | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Klebsiella pneumoniae SuhB | | Authors: | Jena, A.K., Yadav, V.K., Bhattacharyya, S. | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9vew | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | SIRT2 structure in complex with H3K18myr peptide and native NAD: pre-catalysis state 2 | | Authors: | Zhang, N., Hao, Q. | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9vex | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of CpaO in complex with beta-CPA | | Authors: | Chang, C.Y., Cheng, T., Kuo, Y.M., Hsiao, P.Y., Wang, M., Wang, N. | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9vfd | | Status: | HPUB -- hold until publication | | Title: | Cytochrome P450 CYP153A99 from Pseudomonas sp. 19-rlim, complexed with dehydroabietic acid | | Authors: | Liu, X.D., Dong, L.-B. | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9vfc | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9vfa | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9vf9 | | Status: | HPUB -- hold until publication | | Title: | GSTM1 in complex with bithionol | | Authors: | Sun, Q. | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9vf4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9ver | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9vet | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9vev | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9vfb | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9veq | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Keap1 in complex with a small molecule inhibitor, KMN003 | | Authors: | Ishida, H., Osawa, M. | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9vf5 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of apo form of Arthrobacter psychrolactophillus L-arabinose isomerase | | Authors: | Laksmi, F.A., Nugraha, Y., Jayawardena, N., Raschdorf, O., chek, M., Kohga, H., Herliana, L., Fathoni, A., Hidayat, I. | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9vey | | Status: | HOLD -- hold until a certain date | | Title: | Ethanol dehydrogenase of Pseudomonas syringae pv. actinidiae | | Authors: | Li, X.Y., Luo, X., Zhang, S.Q., Xing, Z.F. | | Deposition date: | 2025-06-10 | | Release date: | 2026-06-10 |
|
| PDBID: | 9vf2 | | Status: | PROC -- to be processed | | Title: | Spirooxindole inhibitor CG-1059 complexed with SARS-Cov-2 3CL protease | | Authors: | Tang, X., Chen, X., Hou, K., Fan, W. | | Deposition date: | 2025-06-10 | | Release date: | 2026-06-10 |
|
| PDBID: | 9vf3 | | Status: | PROC -- to be processed | | Title: | Spirooxindole inhibitor CG-1062 complexed with SARS-Cov-2 3CL protease | | Authors: | Tang, X., Chen, X., Hou, K., Fan, W. | | Deposition date: | 2025-06-10 | | Release date: | 2026-06-10 |
|
| PDBID: | 9veu | | Status: | HPUB -- hold until publication | | Title: | Structure of the magnesium channel CorA from Mycobacterium tuberculosis in the presence of Mg2+ | | Authors: | Chen, X., Li, M. | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9vf6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9p1q | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Ube2E3 | | Authors: | Cook, M.W., Brzovic, P.S., Stenkamp, R.E. | | Deposition date: | 2025-06-10 | | Sequence: | >Entity 1
MTSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSSDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYLTNRAEHDRIARQWTKRYAT
|
|
| PDBID: | 9p1k | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of sensory domain of CdgA from Vibrio cholerae O1 biovar El Tor str. N16961 | | Authors: | Marceau, A.H., Mariscal, V.T., Tripathi, S.M., Yildiz, F.H., Rubin, S.M. | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9p1l | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9p1h | | Status: | HPUB -- hold until publication | | Title: | 100K human S-adenosylmethionine decarboxylase | | Authors: | Patel, J.R., Bonzon, T.J., Bahkt, T., Faghobun, O.O., Clinger, J.A. | | Deposition date: | 2025-06-10 | | Sequence: | >Entity 1
(PYR)SMFVSKRRFILKTCGTTLLLKALVPLLKLARDYSGFDSIQSFFYSRKNFMKPSHQGYPHRNFQEEIEFLNAIFPNGAAYCMGRMNSDCWYLYTLDFPESRVISQPDQTLEILMSELDPAVMDQFYMKDGVTAKDVTRESGIRDLIPGSVIDATMFNPCGYSMNGMKSDGTYWTIHITPEPEFSYVSFETNLSQTSYDDLIRKVVEVFKPGKFVTTLFVNQSSKCRTVLASPQKIEGFKRLDCQSAMFNDYNFVFTSFAKKQQQQQS
>Entity 2
MHHHHHHENLYFQGEAAHFFEGTEKLLEVWFSRQQPDANQGSGDLRTIPRSEWDILLKDVQCSIISVTKTDKQEAYVLSE
|
|
