| PDBID: | 9qdd | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Nitratidesulfovibrio vulgaris [FeFe]-hydrogenase crystallized in the sodium acetate buffer at pH 5.3 | | Authors: | Bikbaev, K., Span, I. | | Deposition date: | 2025-03-06 | | Release date: | 2025-04-03 |
|
| PDBID: | 9qdn | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-03-06 |
|
| PDBID: | 9qdm | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-03-06 |
|
| PDBID: | 9qdq | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-06 |
|
| PDBID: | 9m61 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of 5-HT2BR in complex with RS127445 | | Authors: | Zhong, Y.X., Guo, Q., Tao, Y.Y. | | Deposition date: | 2025-03-06 |
|
| PDBID: | 9m5w | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-06 |
|
| PDBID: | 9m5p | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | I-shaped amyloid fiber (40) of Tottori (D7N) mutant | | Authors: | Burton-Smith, R.N., Murata, K. | | Deposition date: | 2025-03-06 |
|
| PDBID: | 9m5r | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | V''-shaped short pitch amyloid fiber (40) of Tottori (D7N) mutant | | Authors: | Burton-Smith, R.N., Murata, K. | | Deposition date: | 2025-03-06 |
|
| PDBID: | 9m5q | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | V-shaped amyloid fiber (40) of Tottori (D7N) mutant | | Authors: | Burton-Smith, R.N., Murata, K. | | Deposition date: | 2025-03-06 |
|
| PDBID: | 9m60 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of 5-HT2BR in complex with ritanseirn | | Authors: | Zhong, Y.X., Guo, Q., Tao, Y.Y. | | Deposition date: | 2025-03-06 |
|
| PDBID: | 9m5s | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-06 |
|
| PDBID: | 9m5k | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | The cryo-EM structure of in situ amplified (ISA) alpha-synuclein fibrils from PD homogenate | | Authors: | Cao, T.Y., Zhao, Q.Y., Liu, C., Li, D. | | Deposition date: | 2025-03-06 |
|
| PDBID: | 9m5v | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-03-06 |
|
| PDBID: | 9m5m | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-06 |
|
| PDBID: | 9m5n | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-06 |
|
| PDBID: | 9m5o | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-06 | | Sequence: | >Entity 1
AERENLKNEATKVLEHVCEDINKESYGFVKISKMKENEKEIRLFNLEEIYHSLMKVGGSGATDGGKREDDAASHSVVAESNGAHLLQSDIWVRGRIHDIRSKGSLAFIILRHKLYSMQCILDIKHNDNDKNMMKWVSNLPLESIVDIKGKLSKPEVPIDSTNIKYEAHIRKIFCISKTAKELPFLLKDANMKETNEEGSIKVNQDNRLNNRCVDLRTYANYSIFCLQSQICTIFKNFLLENNFIEIHTPKLLGESSEGGANAFQINYFNQKGFLAQSPQLYKQMCINSGFDRVFEVAPVFRAENSNTYRHLCEYVSLDVEMTYKYDYLENVHFYDSMFKHIFTELSKGGKNEMLIKTVKGQYPCEDFQWLEETPIFTYEEAIKMLIQHGKLHLKEEEILAYDMSTDMEKELGKIVKASHHTDYYIIINFPSALRPFYTMYKEDEPAISNSYDFFMRGEEILSGSQRISDVNLLLENIKRFNLDANKLNFYIDSFAYSSYPHSGCGIGLERVLMLFLGLNNIRKTSLFPRDPKRLIP
|
|
| PDBID: | 9m5t | | Status: | HPUB -- hold until publication | | Title: | Structure of the flagellar filament in short-length at 3.02 angstroms resolution | | Authors: | Chen, L.X., Jiang, W.X., Cheng, X.Q., Dong, X., Xing, Q. | | Deposition date: | 2025-03-06 |
|
| PDBID: | 9m5l | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | The cryo-EM structure of in situ amplified (ISA) alpha-synuclein fibrils from DLB homogenate | | Authors: | Cao, T.Y., Zhao, Q.Y., Liu, C., Li, D. | | Deposition date: | 2025-03-06 |
|
| PDBID: | 9m5u | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2025-03-06 |
|
| PDBID: | 9m62 | | Status: | HOLD -- hold until a certain date | | Title: | X-ray Crystal Structure of Pseudoazurin Met16Arg variant, oxidized form at pH 7.0 | | Authors: | Nemoto, I., Yamaguchi, T., Kohzuma, T. | | Deposition date: | 2025-03-06 | | Release date: | 2026-03-06 | | Sequence: | >Entity 1
ADFEVHMLNKGKDGARVFEPASLKVAPGDTVTFIPTDKGHNVETIKGMIPDGAEAFKSKINENYKVTFTAPGVYGVKCTPHYGMGMVGVVQVGDAPANLEAVKGAKNPKKAQERLDAALAALGN
|
|
| PDBID: | 9m5x | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-03-06 |
|
| PDBID: | 9m5y | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | the crystal structure of the Ca2+/CaM-CASK-CaMK complex | | Authors: | Li, W., Wang, Y. | | Deposition date: | 2025-03-06 |
|
| PDBID: | 9m5z | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-03-06 |
|
| PDBID: | 9nnu | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of Ebola Envelope glycoprotein GP in complex with compound LD4-189ZbR | | Authors: | Agrawal, S., Wilson, I.A. | | Deposition date: | 2025-03-06 |
|
| PDBID: | 9nnt | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-03-06 |
|
