| PDBID: | 7i90 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of 7 bound to the ph domain of Btk | | Authors: | Brear, P., West, R.M., Nicolescu, R.C.B., Blaszczyk, B.K., Anwar, A., Deingruber, T., Sanders, M.G., Perez-Areales, F.J., Stephens, L.R., Hawkins, P.T., Spring, D.R., Hyvonen, M. | | Deposition date: | 2025-03-24 |
|
| PDBID: | 7i91 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of 13 bound to the ph domain of Btk | | Authors: | Brear, P., West, R.M., Nicolescu, R.C.B., Blaszczyk, B.K., Anwar, A., Deingruber, T., Sanders, M.G., Perez-Areales, F.J., Stephens, L.R., Hawkins, P.T., Spring, D.R., Hyvonen, M. | | Deposition date: | 2025-03-24 |
|
| PDBID: | 7i92 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of 9 bound to the ph domain of Btk | | Authors: | Brear, P., West, R.M., Nicolescu, R.C.B., Blaszczyk, B.K., Anwar, A., Deingruber, T., Sanders, M.G., Perez-Areales, F.J., Stephens, L.R., Hawkins, P.T., Spring, D.R., Hyvonen, M. | | Deposition date: | 2025-03-24 |
|
| PDBID: | 7i93 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of 27 bound to the ph domain of Btk | | Authors: | Brear, P., West, R.M., Nicolescu, R.C.B., Blaszczyk, B.K., Anwar, A., Deingruber, T., Sanders, M.G., Perez-Areales, F.J., Stephens, L.R., Hawkins, P.T., Spring, D.R., Hyvonen, M. | | Deposition date: | 2025-03-24 |
|
| PDBID: | 7i94 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of 33 bound to the ph domain of Btk | | Authors: | Brear, P., West, R.M., Nicolescu, R.C.B., Blaszczyk, B.K., Anwar, A., Deingruber, T., Sanders, M.G., Perez-Areales, F.J., Stephens, L.R., Hawkins, P.T., Spring, D.R., Hyvonen, M. | | Deposition date: | 2025-03-24 |
|
| PDBID: | 7i95 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of 25 bound to the ph domain of Btk | | Authors: | Brear, P., West, R.M., Nicolescu, R.C.B., Blaszczyk, B.K., Anwar, A., Deingruber, T., Sanders, M.G., Perez-Areales, F.J., Stephens, L.R., Hawkins, P.T., Spring, D.R., Hyvonen, M. | | Deposition date: | 2025-03-24 |
|
| PDBID: | 7i96 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of 4 bound to the ph domain of Btk | | Authors: | Brear, P., West, R.M., Nicolescu, R.C.B., Blaszczyk, B.K., Anwar, A., Deingruber, T., Sanders, M.G., Perez-Areales, F.J., Stephens, L.R., Hawkins, P.T., Spring, D.R., Hyvonen, M. | | Deposition date: | 2025-03-24 |
|
| PDBID: | 7i97 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of 8 bound to the ph domain of Btk | | Authors: | Brear, P., West, R.M., Nicolescu, R.C.B., Blaszczyk, B.K., Anwar, A., Deingruber, T., Sanders, M.G., Perez-Areales, F.J., Stephens, L.R., Hawkins, P.T., Spring, D.R., Hyvonen, M. | | Deposition date: | 2025-03-24 |
|
| PDBID: | 7i98 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of 10 bound to the ph domain of Btk | | Authors: | Brear, P., West, R.M., Nicolescu, R.C.B., Blaszczyk, B.K., Anwar, A., Deingruber, T., Sanders, M.G., Perez-Areales, F.J., Stephens, L.R., Hawkins, P.T., Spring, D.R., Hyvonen, M. | | Deposition date: | 2025-03-24 |
|
| PDBID: | 7i99 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of 22 bound to the ph domain of Btk | | Authors: | Brear, P., West, R.M., Nicolescu, R.C.B., Blaszczyk, B.K., Anwar, A., Deingruber, T., Sanders, M.G., Perez-Areales, F.J., Stephens, L.R., Hawkins, P.T., Spring, D.R., Hyvonen, M. | | Deposition date: | 2025-03-24 |
|
| PDBID: | 7i9a | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of 24 bound to the ph domain of Btk | | Authors: | Brear, P., West, R.M., Nicolescu, R.C.B., Blaszczyk, B.K., Anwar, A., Deingruber, T., Sanders, M.G., Perez-Areales, F.J., Stephens, L.R., Hawkins, P.T., Spring, D.R., Hyvonen, M. | | Deposition date: | 2025-03-24 |
|
| PDBID: | 7i9b | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of 32 bound to the ph domain of Btk | | Authors: | Brear, P., West, R.M., Nicolescu, R.C.B., Blaszczyk, B.K., Anwar, A., Deingruber, T., Sanders, M.G., Perez-Areales, F.J., Stephens, L.R., Hawkins, P.T., Spring, D.R., Hyvonen, M. | | Deposition date: | 2025-03-24 |
|
| PDBID: | 7i9c | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of 30 bound to the ph domain of Btk | | Authors: | Brear, P., West, R.M., Nicolescu, R.C.B., Blaszczyk, B.K., Anwar, A., Deingruber, T., Sanders, M.G., Perez-Areales, F.J., Stephens, L.R., Hawkins, P.T., Spring, D.R., Hyvonen, M. | | Deposition date: | 2025-03-24 |
|
| PDBID: | 7i9d | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of 14 bound to the ph domain of Btk | | Authors: | Brear, P., West, R.M., Nicolescu, R.C.B., Blaszczyk, B.K., Anwar, A., Deingruber, T., Sanders, M.G., Perez-Areales, F.J., Stephens, L.R., Hawkins, P.T., Spring, D.R., Hyvonen, M. | | Deposition date: | 2025-03-24 |
|
| PDBID: | 7i9e | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of 18 bound to the ph domain of Btk | | Authors: | Brear, P., West, R.M., Nicolescu, R.C.B., Blaszczyk, B.K., Anwar, A., Deingruber, T., Sanders, M.G., Perez-Areales, F.J., Stephens, L.R., Hawkins, P.T., Spring, D.R., Hyvonen, M. | | Deposition date: | 2025-03-24 |
|
| PDBID: | 7i9f | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of 16 bound to the ph domain of Btk | | Authors: | Brear, P., West, R.M., Nicolescu, R.C.B., Blaszczyk, B.K., Anwar, A., Deingruber, T., Sanders, M.G., Perez-Areales, F.J., Stephens, L.R., Hawkins, P.T., Spring, D.R., Hyvonen, M. | | Deposition date: | 2025-03-24 |
|
| PDBID: | 7i9g | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of 28 bound to the ph domain of Btk | | Authors: | Brear, P., West, R.M., Nicolescu, R.C.B., Blaszczyk, B.K., Anwar, A., Deingruber, T., Sanders, M.G., Perez-Areales, F.J., Stephens, L.R., Hawkins, P.T., Spring, D.R., Hyvonen, M. | | Deposition date: | 2025-03-24 |
|
| PDBID: | 7i9h | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of 26 bound to the ph domain of Btk | | Authors: | Brear, P., West, R.M., Nicolescu, R.C.B., Blaszczyk, B.K., Anwar, A., Deingruber, T., Sanders, M.G., Perez-Areales, F.J., Stephens, L.R., Hawkins, P.T., Spring, D.R., Hyvonen, M. | | Deposition date: | 2025-03-24 |
|
| PDBID: | 7i9i | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of 2 bound to the ph domain of Btk | | Authors: | Brear, P., West, R.M., Nicolescu, R.C.B., Blaszczyk, B.K., Anwar, A., Deingruber, T., Sanders, M.G., Perez-Areales, F.J., Stephens, L.R., Hawkins, P.T., Spring, D.R., Hyvonen, M. | | Deposition date: | 2025-03-24 |
|
| PDBID: | 9nws | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-03-24 |
|
| PDBID: | 9nwt | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of DDB1dB:CRBN:mezigdomide:SALL4(392-449;G416A) | | Authors: | Park, J., Hunkeler, M., Roy Burman, S.S., Fischer, E.S. | | Deposition date: | 2025-03-24 |
|
| PDBID: | 9nww | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Single-particle cryo-EM structure of the first variant of mobilized colistin resistance (MCR-1) in its ligand-bound state | | Authors: | Zinkle, A.P., Bunuro-Batista, M., Herrera, C.M., Erramilli, S.K., Kloss, B., Ashraf, K.U., Nosol, K., Zhang, G., Cater, R.J., Marty, M.T., Kossiakoff, A.A., Trent, M.S., Nygaard, R., Stansfeld, P.J., Mancia, F. | | Deposition date: | 2025-03-24 |
|
| PDBID: | 9nwu | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of a high affinity Lv-Hv tetrabody for the erythropoietin receptor | | Authors: | Singer, A.U., Bruce, H.A., Yang, N., Blazer, L.L., Adams, J.J., Sidhu, S.S. | | Deposition date: | 2025-03-24 | | Sequence: | >Entity 1
DIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYSASSLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQSSYSLITFGQGTKVEIKGGGGGEVQLVESGGGLVQPGGSLRLSCAASGFNLRSYYMHWVRQAPGKGLEWVASISPYYSYTYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARHGYGAMDYWGQGTLVTVSS
|
|
| PDBID: | 9nwn | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-03-24 |
|
| PDBID: | 9nwl | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of glycine-betaine demethylase subunit GbcA from Pseudomonas aeruginosa | | Authors: | Tan, K., Joachimiak, A., Munoz-Clares, R.A. | | Deposition date: | 2025-03-24 |
|
