PDBID: | 8r4a | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-13 |
|
PDBID: | 8r4h | Status: | HPUB -- hold until publication | Title: | Crystal structure of the copper efflux oxidase (CueO) from Hafnia alvei deleted of the Met-rich domain | Authors: | Leone, P., Contaldo, U. | Deposition date: | 2023-11-13 |
|
PDBID: | 8uy7 | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-13 |
|
PDBID: | 8uy9 | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-13 |
|
PDBID: | 8uya | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-13 |
|
PDBID: | 8uy8 | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-13 |
|
PDBID: | 8uyq | Status: | AUTH -- processed, waiting for author review and approval | Title: | Consensus olfactory receptor consOR4 bound to 2-methylthiazoline and in complex with mini-Gs trimeric protein | Authors: | Billesboelle, C.B., Del Torrent, C.L., Manglik, A. | Deposition date: | 2023-11-13 |
|
PDBID: | 8uy6 | Status: | HPUB -- hold until publication | Title: | Aquaporin Z with ALFA tag and bound to nanobody | Authors: | Stover, L., Bahramimoghaddam, H., Wang, L., Zhou, M., Laganowsky, A. | Deposition date: | 2023-11-13 |
|
PDBID: | 8uy5 | Status: | HPUB -- hold until publication | Title: | [ZP] Self-assembling DNA crystal with expanded genetic code using C,A,T,G, Z and P nucleotides | Authors: | Vecchioni, S., Sha, R., Ohayon, Y.P., Hernandez, C. | Deposition date: | 2023-11-13 |
|
PDBID: | 8uyn | Status: | HPUB -- hold until publication | Title: | Fundamental Characterization of Chelated and Crystallized Actinium in a Macromolecular Host | Authors: | Rupert, P.B., Strong, R.K. | Deposition date: | 2023-11-13 | Sequence: | >Entity 1 QDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGSQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCIDG
|
|
PDBID: | 8uyb | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-13 |
|
PDBID: | 8uyc | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-13 |
|
PDBID: | 8uy4 | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-13 |
|
PDBID: | 8uy3 | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Title: | Fem1B with FNIP1 and Tom20 fragment | Authors: | Gee, C.L., Manford, A.G., McMinimy, R., Rape, M. | Deposition date: | 2023-11-12 | Release date: | 2024-11-12 |
|
PDBID: | 8uxv | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-11 |
|
PDBID: | 8uxz | Status: | HPUB -- hold until publication | Title: | Structure of E. coli acetyl-CoA carboxylase (local reconstruction of the wide helical tube at 3.31 Angstrom resolution) | Authors: | Xu, X., Silva de Sousa, A., Boram, T.J., Jiang, W., Lohman, R.J. | Deposition date: | 2023-11-11 |
|
PDBID: | 8uxy | Status: | HPUB -- hold until publication | Title: | Consensus olfactory receptor consOR1 bound to L-menthol and in complex with mini-Gs trimeric protein | Authors: | Billesboelle, C.B., Del Torrent, C.L., Manglik, A. | Deposition date: | 2023-11-11 |
|
PDBID: | 8uy0 | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-11 |
|
PDBID: | 8r3y | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-10 |
|
PDBID: | 8r3x | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-10 |
|
PDBID: | 8r40 | Status: | HPUB -- hold until publication | Title: | Crystal structure of diabody CR57 in complex with rabies virus protein G domain III | Authors: | Kedari, A., Rissanen, I. | Deposition date: | 2023-11-10 |
|
PDBID: | 8r3n | Status: | HPUB -- hold until publication | Title: | Crystal structure of PfpI, Pseudomonas aeruginosa PAO1 | Authors: | Grimm, L., Wijaya, A.J. | Deposition date: | 2023-11-10 |
|
PDBID: | 8r3u | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-10 |
|
PDBID: | 8r3w | Status: | HPUB -- hold until publication | Title: | Crystal structure of a homospecific CR57 diabody | Authors: | Kedari, A., Rissanen, I. | Deposition date: | 2023-11-10 |
|
PDBID: | 8uxt | Status: | HPUB -- hold until publication | Title: | Acinetobacter baumannii Tse15 Rhs effector, toxin cleavage mutant (D1369N, D1391N) | Authors: | Hayes, B.K., Venugopal, H., McGowan, S. | Deposition date: | 2023-11-10 |
|