| PDBID: | 9m1n | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9m1w | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of N-prenyltransferase DsKabA | | Authors: | Huang, W.J., Hsu, C.H. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9m1y | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | NMR Structure of Mouse Keratin 17 Tail Domain (G390 - R433) in solution | | Authors: | Yeom, J., Lee, C.H., Kim, J.H. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9m1j | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of the TBC-DE-Arl2-beta-tubulin complex | | Authors: | Seong, Y.J., Kim, H.M., Byun, K.M., Park, Y.W., Roh, S.H. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9m1i | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of the TBC-D-Arl2-beta-tubulin complex | | Authors: | Seong, Y.J., Kim, H.M., Byun, K.M., Park, Y.W., Roh, S.H. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9m1o | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structures of NPFFR2 complex with neuropeptide FF | | Authors: | Pan, B.X., Li, X.Z., Jiang, Y. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9m1z | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of MAP2K6 complexed with 5Z-7-oxozeaenol | | Authors: | Yumura, S., Kinoshita, T. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9m1p | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the histamine-bound zTAAR13d-Gs complex | | Authors: | Zheng, Y., Zhao, S.W. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9m1q | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of N-terminal domain of hypothetical protein Rv1421 from Mycobacterium tuberculosis H37Rv | | Authors: | Lee, K.S., Park, J. | | Deposition date: | 2025-02-26 | | Release date: | 2025-04-23 | | Sequence: | >Entity 1
MMNHARGVENRSEGGGIDVVLVTGLSGAGRGTAAKVLEDLGWYVADNLPPQLITRMVDFGLAAGSRITQLAVVMDVRSRGFTGDLDSVRNELATRAITPRVVFMEASDDTLVRRYEQNRRSHPLQGEQTLAEGIAAERRMLAPVRATADLIIDTSTLSVGGLRDSIERAFGGDG
|
|
| PDBID: | 9m1v | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of N-terminal domain of hypothetical protein Rv1421 from Mycobacterium tuberculosis H37Rv in complex with uridine diphosphate N-acetyl glucosamine | | Authors: | Lee, K.S., Park, J. | | Deposition date: | 2025-02-26 | | Release date: | 2025-08-26 | | Sequence: | >Entity 1
MMNHARGVENRSEGGGIDVVLVTGLSGAGRGTAAKVLEDLGWYVADNLPPQLITRMVDFGLAAGSRITQLAVVMDVRSRGFTGDLDSVRNELATRAITPRVVFMEASDDTLVRRYEQNRRSHPLQGEQTLAEGIAAERRMLAPVRATADLIIDTSTLSVGGLRDSIERAFGGDG
|
|
| PDBID: | 9m1x | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of human heart fatty acid-binding protein at 0.80 A resolution (holo-FABP3) | | Authors: | Sugiyama, S., Maekawa, S., Matsuoka, S., Murata, M. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9m22 | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of human heart fatty acid-binding protein delipidated with Lipidex | | Authors: | Sugiyama, S., Maekawa, S., Matsuoka, S., Murata, M. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9m1r | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9m1s | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9m1t | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9nin | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | The structure of human Vacuolar Protein Sorting 34 catalytic domain bound to RD-I-86 | | Authors: | Cartwright, J.J., Abiodun, W.O., Dass, R., Singleton, J.D., Doukov, T., Peterson, M.A., Moody, J.D. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9nj2 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9nj0 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9nij | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of the acyltransferase domain of NcdE, a multi-domain NRPS protein from nocardichelin biosynthesis | | Authors: | Fisk, M.B., Gulick, A.M. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9nik | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of E1277A mutant of the acyltransferase domain of NcdE, a multi-domain NRPS protein from nocardichelin biosynthesis | | Authors: | Fisk, M.B., Gulick, A.M. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9nil | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of a Y1216F mutant of the acyltransferase domain of NcdE, a multi-domain NRPS protein from nocardichelin biosynthesis | | Authors: | Fisk, M.B., Gulick, A.M., Barrera Ramirez, J. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9nim | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of a K1305A mutant of the acyltransferase domain of NcdE, a multi-domain NRPS protein from nocardichelin biosynthesis | | Authors: | Fisk, M.B., Gulick, A.M., Barrera Ramirez, J. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9nid | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9nie | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9nif | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-26 |
|
