| PDBID: | 9nyr | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of CDK2/CyclinE1 in complex with CRBN/DDB1 and Cpd 24 | | Authors: | Collier, P., Zheng, X., Ford, M., Weiss, M., Aversa, R., Chen, D., Li, K., Growney, J.D., Yang, A., Sathappa, M., Breitkopf, S.B., Enerson, B., Sawant, R., Su, L., Howarth, L., Liang, T., Paul, A., Sharma, K., Williams, J., Kwiatkowski, N.P. | | Deposition date: | 2025-03-28 |
|
| PDBID: | 9nyp | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-28 |
|
| PDBID: | 9nyo | | Status: | HPUB -- hold until publication | | Title: | Clostridium acetobutylicum alcohol dehydrogenase bound to NADP+, disordered nicotinamide | | Authors: | Madzelan, P., Wilson, M.A. | | Deposition date: | 2025-03-28 |
|
| PDBID: | 9nys | | Status: | HPUB -- hold until publication | | Title: | Human DNA Ligase 1 E346A/E592A/K845N triple mutant with 3''-A:T nick | | Authors: | KanalElamparithi, B., Caglayan, M. | | Deposition date: | 2025-03-28 |
|
| PDBID: | 9nyu | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of KwaB dimer | | Authors: | Zhiying, Z., Dinshaw, J.P. | | Deposition date: | 2025-03-28 |
|
| PDBID: | 9nyv | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-28 |
|
| PDBID: | 9nyw | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-03-28 |
|
| PDBID: | 9qpk | | Status: | HPUB -- hold until publication | | Title: | E.coli TalB mutant E96Q, F178Y, R300E | | Authors: | Soderholm, A., Roos, A., Widersten, M. | | Deposition date: | 2025-03-27 |
|
| PDBID: | 9qpg | | Status: | HPUB -- hold until publication | | Title: | Isopenicillin N synthase in complex with Fe and IPN | | Authors: | Rabe, P., Schofield, C.J. | | Deposition date: | 2025-03-27 |
|
| PDBID: | 9qph | | Status: | HPUB -- hold until publication | | Title: | Isopenicillin N synthase in complex with Fe and IPN using tr-SFX | | Authors: | Rabe, P., Schofield, C.J., Stead, A. | | Deposition date: | 2025-03-27 |
|
| PDBID: | 9qpi | | Status: | HPUB -- hold until publication | | Title: | Isopenicillin N synthase in complex with Fe and ACV | | Authors: | Rabe, P., Schofield, C.J., Stead, A. | | Deposition date: | 2025-03-27 |
|
| PDBID: | 9qpe | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-03-27 |
|
| PDBID: | 9qpj | | Status: | HPUB -- hold until publication | | Title: | Isopenicillin N synthase in complex with Fe and IPN using tr-SSX | | Authors: | Rabe, P., Schofield, C.J., Stead, A. | | Deposition date: | 2025-03-27 |
|
| PDBID: | 9qpp | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of human MATa2 in complex with MAT2B isoform v1 at 2.6 A resolution | | Authors: | Khaja, F., Antonyuk, S.V., Muench, S.P., Hasnain, S.S. | | Deposition date: | 2025-03-27 |
|
| PDBID: | 9qpo | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of human MATa2 in complex with MATBv2 at 2.6 A resolution | | Authors: | Khaja, F., Antonyuk, S.V., Muench, S.P., Hasnain, S.S. | | Deposition date: | 2025-03-27 |
|
| PDBID: | 9qpm | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-27 |
|
| PDBID: | 9qpn | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-27 |
|
| PDBID: | 9qpd | | Status: | HPUB -- hold until publication | | Title: | APH(2'''')-IVa with a fragment | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalewski, J., Lionne, C. | | Deposition date: | 2025-03-27 |
|
| PDBID: | 9qpf | | Status: | HPUB -- hold until publication | | Title: | Solution structure of Sox2 DBD | | Authors: | Orsetti, A., van Ingen, H. | | Deposition date: | 2025-03-27 | | Sequence: | >Entity 1
GSNQKNSPDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKTLMKKDKYTL
|
|
| PDBID: | 9qpl | | Status: | HPUB -- hold until publication | | Title: | APH(2'''')-IVa with an inhibitor | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalewski, J., Lionne, C. | | Deposition date: | 2025-03-27 |
|
| PDBID: | 9u9c | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of NDM-1 in complex with hydrolyzed amoxicillin | | Authors: | Shi, X., Zhang, Q., Liu, W. | | Deposition date: | 2025-03-27 |
|
| PDBID: | 9u94 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Fusobacterium nucleatum CbpF in complex with human CEACAM1 | | Authors: | Li, L.J., Shen, F., Zhao, X., Gao, G.F. | | Deposition date: | 2025-03-27 |
|
| PDBID: | 9u93 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Fusobacterium nucleatum CbpF in complex with human CEACAM5 | | Authors: | Li, L.J., Shen, F., Zhao, X., Gao, G.F. | | Deposition date: | 2025-03-27 |
|
| PDBID: | 9u9b | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-27 |
|
| PDBID: | 9u96 | | Status: | HPUB -- hold until publication | | Title: | SARS-CoV2 Main protease(Mpro) complexed with TAB1 peptide | | Authors: | Fu, X. | | Deposition date: | 2025-03-27 |
|
