| PDBID: | 8z3f | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-15 |
|
| PDBID: | 9bee | | Status: | HPUB -- hold until publication | | Title: | alphaB-crystallin N-terminal IXI variant in a fibril state | | Authors: | McFarland, R., Reichow, S.L. | | Deposition date: | 2024-04-15 |
|
| PDBID: | 9bem | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Tungstate binding protein (Tungbindin) from Eubacterium limosum with seven Tungstates bound | | Authors: | Zhou, D., Rose, J.P., Chen, L., Wang, B.C. | | Deposition date: | 2024-04-15 |
|
| PDBID: | 9beb | | Status: | HPUB -- hold until publication | | Title: | Tungstate binding protein (Tungbindin) from Eubacterium limosum with eight Tungstates bound | | Authors: | Zhou, D., Rose, J.P., Chen, L., Wang, B.C. | | Deposition date: | 2024-04-15 |
|
| PDBID: | 9bea | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | SARS CoV-2 full-length spike protein with internal tag, 2RBD-up conformation | | Authors: | Singh, S., Hasan, S.S. | | Deposition date: | 2024-04-15 |
|
| PDBID: | 9be7 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Alkalihalobacillus halodurans (Aha) trp RNA binding attenuation protein (TRAP) mutant dTRAP without Trp | | Authors: | Yang, H., Stachowski, K., Foster, M. | | Deposition date: | 2024-04-15 |
|
| PDBID: | 9be8 | | Status: | HPUB -- hold until publication | | Title: | Alkalihalobacillus halodurans (Aha) trp RNA binding attenuation protein (TRAP) mutant T49A/T52A dTRAP with Trp | | Authors: | Yang, H., Stachowski, K., Foster, M. | | Deposition date: | 2024-04-15 | | Sequence: | >Entity 1
MNVGDNSNFFVIKAKENGVNVFGMTRGTDTRFHHSEKLDKGEVMIAQFTEHTSAVKIRGKAIIQTSYGTLDTEKDEGGGGSGGGGSMNVGDNSNFFVIKAKENGVNVFGMTRGTDTRFHHSEKLDKGEVMIAQFAEHASAVKIRGKAIIQTSYGTLDTEKDEENLYFQ
|
|
| PDBID: | 9be9 | | Status: | HPUB -- hold until publication | | Title: | HIV-1 Env 16055 dGly4 NFL | | Authors: | Ozorowski, G., Lee, W.-H., Ward, A.B. | | Deposition date: | 2024-04-15 |
|
| PDBID: | 9bec | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-15 |
|
| PDBID: | 9bed | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Tungstate binding protein (Tungbindin) from Eubacterium limosum with eight molybdates bound | | Authors: | Zhou, D., Rose, J.P., Chen, L., Wang, B.C. | | Deposition date: | 2024-04-15 |
|
| PDBID: | 9bel | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Tungstate binding protein (Tungbindin) from Eubacterium limosum with five Tungstates bound | | Authors: | Zhou, D., Rose, J.P., Chen, L., Wang, B.C. | | Deposition date: | 2024-04-15 |
|
| PDBID: | 9bef | | Status: | HPUB -- hold until publication | | Title: | Structure of S1_8B, a lambda-carrageenan specific sulfatase, in complex with an oligosaccharide | | Authors: | Hettle, J.A., Vickers, C., Boraston, A.B. | | Deposition date: | 2024-04-15 |
|
| PDBID: | 9beh | | Status: | HPUB -- hold until publication | | Title: | Structure of GH110A in complex with galactose-6-sulfate | | Authors: | Hettle, J.A., Vickers, C., Boraston, A.B. | | Deposition date: | 2024-04-15 |
|
| PDBID: | 9bek | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-15 |
|
| PDBID: | 9be5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-14 |
|
| PDBID: | 9be6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-14 |
|
| PDBID: | 9f01 | | Status: | HPUB -- hold until publication | | Title: | Complex between D-SH2 domain of ABL with nanobody DAM21.3 | | Authors: | Essen, L.-O., Hantschel, O., Schmidt, N., Korf, L. | | Deposition date: | 2024-04-14 |
|
| PDBID: | 9f00 | | Status: | HPUB -- hold until publication | | Title: | Complex between D-SH2 domain of ABL with monobody DAM27 | | Authors: | Essen, L.-O., Hantschel, O., Schmidt, N., Korf, L. | | Deposition date: | 2024-04-14 |
|
| PDBID: | 9ezq | | Status: | HPUB -- hold until publication | | Title: | XFEL structure of the free hNQO1 unmixed (P3083) | | Authors: | Martin-Garcia, J.M., Grieco, A., Botha, S. | | Deposition date: | 2024-04-14 |
|
| PDBID: | 9ezr | | Status: | HPUB -- hold until publication | | Title: | XFEL structure of hNQO1 mixed with NADH for 300 ms (P3083) | | Authors: | Martin-Garcia, J.M., Grieco, A., Botha, S. | | Deposition date: | 2024-04-14 |
|
| PDBID: | 9ezs | | Status: | HPUB -- hold until publication | | Title: | XFEL structure of free hNQO1 unmixed (P4502) | | Authors: | Martin-Garcia, J.M., Grieco, A., Botha, S. | | Deposition date: | 2024-04-14 |
|
| PDBID: | 9ezt | | Status: | HPUB -- hold until publication | | Title: | XFEL structure of hNQO1 mixed with NADH for 1190ms (P4502) | | Authors: | Martin-Garcia, J.M., Grieco, A., Botha, S. | | Deposition date: | 2024-04-14 |
|
| PDBID: | 9ezu | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-14 |
|
| PDBID: | 9ezy | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-04-14 |
|
| PDBID: | 9ezv | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-14 |
|
