| PDBID: | 9lsp | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of T2R-TTL-W36 Ccomplex | | Authors: | Wu, C.Y., Wang, Y.X. | | Deposition date: | 2025-02-04 |
|
| PDBID: | 9lsq | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of T2R-TTL-W37 Ccomplex | | Authors: | Wu, C.Y., Wang, Y.X. | | Deposition date: | 2025-02-04 |
|
| PDBID: | 9lst | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of T2R-TTL-W48 Ccomplex | | Authors: | Wu, C.Y., Wang, Y.X. | | Deposition date: | 2025-02-04 |
|
| PDBID: | 9lsu | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of T2R-TTL-W49 Complex | | Authors: | Wu, C.Y., Wang, Y.X. | | Deposition date: | 2025-02-04 |
|
| PDBID: | 9lsv | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of T2R-TTL-W66 Complex | | Authors: | Wu, C.Y., Wang, Y.X. | | Deposition date: | 2025-02-04 |
|
| PDBID: | 9i7x | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-03 |
|
| PDBID: | 9i7w | | Status: | HPUB -- hold until publication | | Title: | Extended and wrapped protein P7 dimers of dimers, the P1 layer and the RNA-dependent RNA polymerase P2 in transcribing particles of bacteriophage phi6 | | Authors: | Kumpula, E.-P., Ilca, S.L., Huiskonen, J.T. | | Deposition date: | 2025-02-03 |
|
| PDBID: | 9i80 | | Status: | HPUB -- hold until publication | | Title: | LecA in complex with a tolcapone derivative glycomimetic | | Authors: | Varrot, A. | | Deposition date: | 2025-02-03 | | Sequence: | >Entity 1
AWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLICHDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKDQS
|
|
| PDBID: | 9i7y | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of KRasG13C in Complex with Nucleotide-based Covalent Inhibitor 7b | | Authors: | Niggenaber, J., Mueller, M.P., Rauh, D. | | Deposition date: | 2025-02-03 |
|
| PDBID: | 9i7z | | Status: | HPUB -- hold until publication | | Title: | LecA in complex with 2-fluoro non-carbohydrate glycomimetic | | Authors: | Varrot, A. | | Deposition date: | 2025-02-03 | | Sequence: | >Entity 1
AWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLICHDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKDQS
|
|
| PDBID: | 9n4k | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-03 |
|
| PDBID: | 9n51 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-03 |
|
| PDBID: | 9n50 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-03 |
|
| PDBID: | 9n4w | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-03 |
|
| PDBID: | 9n4v | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-03 |
|
| PDBID: | 9n4y | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-03 |
|
| PDBID: | 9n54 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Bipartite p63 NLS in complex with Importin Alpha 2 | | Authors: | Esmaeili, S., Swarbrick, C.M.D., Forwood, J.K. | | Deposition date: | 2025-02-03 |
|
| PDBID: | 9n4z | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | CCW Flagellar Switch Complex - FliF, FliG, FliM, and FliN forming 34-mer C-ring from Salmonella | | Authors: | Singh, P.K., Iverson, T.M. | | Deposition date: | 2025-02-03 |
|
| PDBID: | 9n4j | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of rabbit TRPM3 in complex with CIM0216 at 18 degrees Celsius | | Authors: | Kumar, S., Lu, W., Du, J. | | Deposition date: | 2025-02-03 |
|
| PDBID: | 9n55 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | X-ray Crystallographic Structure of Lipid-bound Orf9b Homodimer | | Authors: | San Felipe, C.J., Fraser, J.S. | | Deposition date: | 2025-02-03 |
|
| PDBID: | 9n4l | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-03 |
|
| PDBID: | 9n4m | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-03 |
|
| PDBID: | 9n4n | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-03 |
|
| PDBID: | 9n4o | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-03 |
|
| PDBID: | 9n4p | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-03 |
|
