| PDBID: | 9lz4 | | Status: | HPUB -- hold until publication | | Title: | Reductive-half reaction intermediate of copper amine oxidase from Arthrobacter globiformis captured by mix-and-inject serial crystallography at 200-ms time delay | | Authors: | Murakawa, T., Okajima, T. | | Deposition date: | 2025-02-21 |
|
| PDBID: | 9lz5 | | Status: | HPUB -- hold until publication | | Title: | Reductive-half reaction intermediate of copper amine oxidase from Arthrobacter globiformis captured by mix-and-inject serial crystallography at 300-ms time delay | | Authors: | Murakawa, T., Okajima, T. | | Deposition date: | 2025-02-21 |
|
| PDBID: | 9lz6 | | Status: | HPUB -- hold until publication | | Title: | Reductive-half reaction intermediate of copper amine oxidase from Arthrobacter globiformis captured by mix-and-inject serial crystallography at 400-ms time delay | | Authors: | Murakawa, T., Okajima, T. | | Deposition date: | 2025-02-21 |
|
| PDBID: | 9lz7 | | Status: | HPUB -- hold until publication | | Title: | Reductive-half reaction intermediate of copper amine oxidase from Arthrobacter globiformis captured with short-a-axis diffraction data by mix-and-inject serial crystallography at 22-ms time delay | | Authors: | Murakawa, T., Okajima, T. | | Deposition date: | 2025-02-21 | | Sequence: | >Entity 1
ASPFRLASAGEISEVQGILRTAGLLGPEKRIAYLGVLDPARGAGSEAEDRRFRVFIHDVSGARPQEVTVSVTNGTVISAVELDTAATGELPVLEEEFEVVEQLLATDERWLKALAARNLDVSKVRVAPLSAGVFEYAEERGRRILRGLAFVQDFPEDSAWAHPVDGLVAYVDVVSKEVTRVIDTGVFPVPAEHGNYTDPELTGPLRTTQKPISITQPEGPSFTVTGGNHIEWEKWSLDVGFDVREGVVLHNIAFRDGDRLRPIINRASIAEMVVPYGDPSPIRSWQNYFDTGEYLVGQYANSLELGCDCLGDITYLSPVISDAFGNPREIRNGICMHEEDWGILAKHSDLWSGINYTRRNRRMVISFFTTIGN(2TY)DYGFYWYLYLDGTIEFEAKATGVVFTSAFPEGGSDNISQLAPGLGAPFHQHIFSARLDMAIDGFTNRVEEEDVVRQTMGPGNERGNAFSRKRTVLTRESEAVREADARTGRTWIISNPESKNRLNEPVGYKLHAHNQPTLLADPGSSIARRAAFATKDLWVTRYADDERYPTGDFVNQHSGGAGLPSYIAQDRDIDGQDIVVWHTFGLTHFPRVEDWPIMPVDTVGFKLRPEGFFDRSPVLDVPAN
|
|
| PDBID: | 9lz8 | | Status: | HPUB -- hold until publication | | Title: | Reductive-half reaction intermediate of copper amine oxidase from Arthrobacter globiformis captured with long-a-axis diffraction data by mix-and-inject serial crystallography at 22-ms time delay | | Authors: | Murakawa, T., Okajima, T. | | Deposition date: | 2025-02-21 |
|
| PDBID: | 9lz9 | | Status: | HPUB -- hold until publication | | Title: | Reductive-half reaction intermediate of copper amine oxidase from Arthrobacter globiformis captured with short-a-axis diffraction data by mix-and-inject serial crystallography at 25-ms time delay | | Authors: | Murakawa, T., Okajima, T. | | Deposition date: | 2025-02-21 |
|
| PDBID: | 9lza | | Status: | HPUB -- hold until publication | | Title: | Reductive-half reaction intermediate of copper amine oxidase from Arthrobacter globiformis captured with long-a-axis diffraction data by mix-and-inject serial crystallography at 25-ms time delay | | Authors: | Murakawa, T., Okajima, T. | | Deposition date: | 2025-02-21 |
|
| PDBID: | 9lzb | | Status: | HPUB -- hold until publication | | Title: | Reductive-half reaction intermediate of copper amine oxidase from Arthrobacter globiformis captured with short-a-axis diffraction data by mix-and-inject serial crystallography at 50-ms time delay | | Authors: | Murakawa, T., Okajima, T. | | Deposition date: | 2025-02-21 |
|
| PDBID: | 9lzc | | Status: | HPUB -- hold until publication | | Title: | Reductive-half reaction intermediate of copper amine oxidase from Arthrobacter globiformis captured with long-a-axis diffraction data by mix-and-inject serial crystallography at 50-ms time delay | | Authors: | Murakawa, T., Okajima, T. | | Deposition date: | 2025-02-21 |
|
| PDBID: | 9lzd | | Status: | HPUB -- hold until publication | | Title: | Oxidative form of copper amine oxidase from Arthrobacter globiformis determined at pH 9.0 by single-flow serial crystallography | | Authors: | Murakawa, T., Okajima, T. | | Deposition date: | 2025-02-21 |
|
| PDBID: | 9lze | | Status: | HPUB -- hold until publication | | Title: | Reductive-half reaction intermediate of copper amine oxidase from Arthrobacter globiformis captured by mix-and-inject serial crystallography at 500-ms time delay | | Authors: | Murakawa, T., Okajima, T. | | Deposition date: | 2025-02-21 |
|
| PDBID: | 9lzf | | Status: | HPUB -- hold until publication | | Title: | Reductive-half reaction intermediate of copper amine oxidase from Arthrobacter globiformis captured by mix-and-inject serial crystallography at 1000-ms time delay | | Authors: | Murakawa, T., Okajima, T. | | Deposition date: | 2025-02-21 |
|
| PDBID: | 9lz2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-21 |
|
| PDBID: | 9lyt | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of Mucuna sempervirens Pathogenesis-related protein 1 | | Authors: | Zha, H.G., Fan, S.L. | | Deposition date: | 2025-02-21 |
|
| PDBID: | 9lyv | | Status: | HPUB -- hold until publication | | Title: | structure of prrx bound to DNA | | Authors: | Dong, C., Yan, X.J., Guo, S.M., Huang, Y.L. | | Deposition date: | 2025-02-21 |
|
| PDBID: | 9lyu | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of glycerol kinase from Entamoeba histolytica (Ligand-free form) | | Authors: | Balogun, E.O., Jeelani, G., Hane, E., Kondo, H., Hasegawa, Y., Kojima, C., Chishima, T., Harada, S., Kishikawa, J., Nozaki, T., Shiba, T. | | Deposition date: | 2025-02-21 |
|
| PDBID: | 9lyx | | Status: | HPUB -- hold until publication | | Title: | hCTPS1 with CTP and DON | | Authors: | Guo, C.J., Bao, X.J., Liu, J.L. | | Deposition date: | 2025-02-21 | | Sequence: | >Entity 1
MKYILVTGGVISGIGKGIIASSVGTILKSCGLHVTSIKIDPYINIDAGTFSPYEHGEVFVLDDGGEVDLDLGNYERFLDIRLTKDNNLTTGKIYQYVINKERKGDYLGKTVQVVPHITDAIQEWVMRQALIPVDEDGLEPQVCVIELGGTVGDIESMPFIEAFRQFQFKVKRENFCNIHVSLVPQPSSTGEQKTKPTQNSVRELRGLGLSPDLVVCRCSNPLDTSVKEKISMFCHVEPEQVICVHDVSSIYRVPLLLEEQGVVDYFLRRLDLPIERQPRKMLMKWKEMADRYDRLLETCSIALVGKYTKFSDSYASVIKALEHSALAINHKLEIKYIDSADLEPITSQEEPVRYHEAWQKLCSAHGVLVPGGFGVRGTEGKIQAIAWARNQKKPFLGVCLGMQLAVVEFSRNVLGWQDANSTEFDPTTSHPVVVDMPEHNPGQMGGTMRLGKRRTLFQTKNSVMRKLYGDADYLEERHRHRFEVNPVWKKCLEEQGLKFVGQDVEGERMEIVELEDHPFFVGVQYHPEFLSRPIKPSPPYFGLLLASVGRLSHYLQKGCRLSPRDTYSDRSGSSSPDSEITELKFPSINHD
|
|
| PDBID: | 9lyy | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of glycerol kinase from Entamoeba histolytica complexed with ADP and G3P. | | Authors: | Balogun, E.O., Jeelani, G., Hane, E., Kondo, H., Hasegawa, Y., Kojima, C., Chishima, T., Harada, S., Kishikawa, J., Nozaki, T., Shiba, T. | | Deposition date: | 2025-02-21 |
|
| PDBID: | 9lzg | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of glycerol kinase from Entamoeba histolytica complexed with daphnetin. | | Authors: | Balogun, E.O., Jeelani, G., Hane, E., Kondo, H., Hasegawa, Y., Kojima, C., Chishima, T., Harada, S., Kishikawa, J., Nozaki, T., Shiba, T. | | Deposition date: | 2025-02-21 |
|
| PDBID: | 9lzi | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of glycerol kinase from Entamoeba histolytica complexed with GK-butyl. | | Authors: | Balogun, E.O., Jeelani, G., Hane, E., Kondo, H., Hasegawa, Y., Kojima, C., Chishima, T., Harada, S., Kishikawa, J., Nozaki, T., Shiba, T. | | Deposition date: | 2025-02-21 |
|
| PDBID: | 9lz1 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-21 |
|
| PDBID: | 9ihl | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-21 |
|
| PDBID: | 9ihk | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of carrageenan sulfatase Bt3731_S1_30A from human gut bacterium Bacteroides thetaiotaomicron VPI-3731 | | Authors: | Solanki, V., Parnami, J., Hehemann, J.H. | | Deposition date: | 2025-02-21 | | Release date: | 2025-08-21 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMASASEKPNLIVIQTDEHTINTLGCYRRLVGDINDSPWGKNVVQTPNIDRLAKEGAICTRYYASSPVSTPSRASFQTGLYPVSTGCPINDMPMNPNLITYAEMLKRDGYQTSYVGKWHLGGVPNIGRPYFEPGYNFGYMDRTYMFNDGHWKYFEIVKQPNKIRSYWSGPVKPGFIHVTEYLTDRCLELLERDKNKPFYMMLSIPDPHSPDIASEEYLQKYINLDYEAPETMVTNDTDQRPRWARGGQYNVNKDKFDKKALANYFAMVECVDDNVGRILDFLDKNNLTDNTIVVFTADHGDMLYEHSRVNKGLPYESSARIPFVIRYPEKIIPGKIVNTVYTCVDFAPTILGLMGVKQIPGLQEGINDAQAFTNKEKNVKQDRIVYTTASPFNDWTMATDGRYKLVLSCRETPWLFDLEVDPDEMKNFYNNPKYKEIADRMQKELIRQMKLYKEPALSIGLPYLYKSTDKVNYNPAKYKSKVQPNALLPMIHTIEKVCMRPLK
|
|
| PDBID: | 9ihr | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-21 |
|
| PDBID: | 9ihb | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-21 |
|
