| PDBID: | 9lo5 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | PSI-10LHCI of Haematococcus pluvialis | | Authors: | Zhang, S., Han, W.H., Shen, L.L., Han, G.Y. | | Deposition date: | 2025-01-23 |
|
| PDBID: | 9lox | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-23 |
|
| PDBID: | 9loo | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-23 |
|
| PDBID: | 9lp2 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of de novo designed amantadine induced heterodimer dAIT23.4 | | Authors: | Qihan, J., Longxing, C. | | Deposition date: | 2025-01-23 |
|
| PDBID: | 9lol | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of human MON1A-CCZ1-RAB7A | | Authors: | Li, X., Li, D., Tang, D., Wang, J., Qi, S. | | Deposition date: | 2025-01-23 |
|
| PDBID: | 9loj | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-01-23 | | Release date: | 2026-01-23 |
|
| PDBID: | 9lom | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Study on zine figer structure and fuction of tumor suppressor ZMYND11 | | Authors: | Bai, X., Chen, Z. | | Deposition date: | 2025-01-23 | | Release date: | 2026-01-23 |
|
| PDBID: | 9lou | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-23 |
|
| PDBID: | 9loe | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-23 |
|
| PDBID: | 9lof | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-23 |
|
| PDBID: | 9log | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-23 |
|
| PDBID: | 9lov | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-01-23 |
|
| PDBID: | 9low | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of RamR3.0 complexed with 3-alkenynaphthoate | | Authors: | Chen, X., Qian, J.Y., Yang, X.J., Wu, Y.Z., Zhong, F.R. | | Deposition date: | 2025-01-23 |
|
| PDBID: | 9lok | | Status: | HPUB -- hold until publication | | Title: | The co-crystal structure of PTP1B complex with allosteric inhibitor Fumosorinone | | Authors: | Zhang, J., Lin, L., Yuchi, Z., Luo, D. | | Deposition date: | 2025-01-23 |
|
| PDBID: | 9lod | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-23 |
|
| PDBID: | 9loh | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-23 | | Sequence: | >Entity 1
MSSADKERLARENHSEIERRRRNKMTAYITELSDMVPTCSALARKPDKLTILRMAVSHMKSLRGTGNTSTDGSYKPSFLTDQELKHLILEAADGFLFIVSCETGRVVYVSDSVTPVLNQPQSEWFGSTLYDQVHPDDVDKLREQLSTSENALTGRVLDLKTGTVKKEGQQSSMRMCMGSRRSFICRMRCGTSSVDPVSMNRLSFLRNRCRNGLGSVKEGEPHFVVVHCTGYIKAWPPAGVSLPDDDPEAGQGSKFCLVAIGRLQVTSSPNCTDMSNICQPTEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKTREWLWMRTSSFTFQNPYSDEIEYIICTNTNV
>Entity 2
MADKEKKRSSSELRKEKSRDAARCRRSKETEVFYELAHELPLPHSVSSHLDKASIMRLAISFLRTHKLLSSVCSENESEAEADQQMDNLYLKALEGFIAVVTQDGDMIFLSENISKFMGLTQVELTGHSIFDFTHPCDHEEIRENLTLKNGSGFGKKSKDVSTERDFFMRMKCTVTNRGRTVNLKSATWKVLHCTGQVRVYNNCPPHSSLCGSKEPLLSCLIIMCEPIQHPSHMDIPLDSKTFLSRHSMDMKFTYCDDRILELIGYHPEELLGRSAYEFYHALDSENMTKSHQNLCTKGQVVSGQYRMLAKHGGYVWLETQGTVIYNPRNLQPQCIMCVNYVLSEIEKNDVVFSMDQTESLEHHHHHH
|
|
| PDBID: | 9loi | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-23 | | Sequence: | >Entity 1
MSSADKERLARENHSEIERRRRNKMTAYITELSDMVPTCSALARKPDKLTILRMAVSHMKSLRGTGNTSTDGSYKPSFLTDQELKHLILEAADGFLFIVSCETGRVVYVSDSVTPVLNQPQSEWFGSTLYDQVHPDDVDKLREQLSTSENALTGRVLDLKTGTVKKEGQQSSMRMCMGSRRSFICRMRCGTSSVDPVSMNRLSFLRNRCRNGLGSVKEGEPHFVVVHCTGYIKAWPPAGVSLPDDDPEAGQGSKFCLVAIGRLQVTSSPNCTDMSNICQPTEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKTREWLWMRTSSFTFQNPYSDEIEYIICTNTNV
>Entity 2
MADKEKKRSSSELRKEKSRDAARCRRSKETEVFYELAHELPLPHSVSSHLDKASIMRLAISFLRTHKLLSSVCSENESEAEADQQMDNLYLKALEGFIAVVTQDGDMIFLSENISKFMGLTQVELTGHSIFDFTHPCDHEEIRENLTLKNGSGFGKKSKDVSTERDFFMRMKCTVTNRGRTVNLKSATWKVLHCTGQVRVYNNCPPHSSLCGSKEPLLSCLIIMCEPIQHPSHMDIPLDSKTFLSRHSMDMKFTYCDDRILELIGYHPEELLGRSAYEFYHALDSENMTKSHQNLCTKGQVVSGQYRMLAKHGGYVWLETQGTVIYNPRNLQPQCIMCVNYVLSEIEKNDVVFSMDQTESLEHHHHHH
|
|
| PDBID: | 9lp3 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Aromatic Dioxygenase CpuAdo(Coniochaeta pulveracea) | | Authors: | Wu, B., Yu, L., Wang, Y.H. | | Deposition date: | 2025-01-23 |
|
| PDBID: | 9loq | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-23 |
|
| PDBID: | 9lor | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-23 |
|
| PDBID: | 9loy | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-01-23 |
|
| PDBID: | 9lp0 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-01-23 |
|
| PDBID: | 9lon | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of alpha-synuclein P8 fibril | | Authors: | Xia, W.C., Liu, C. | | Deposition date: | 2025-01-23 | | Release date: | 2026-01-23 |
|
| PDBID: | 9loc | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-23 |
|
| PDBID: | 9lop | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-23 |
|
