PDBID: | 9qdo | Status: | HPUB -- hold until publication | Title: | Crystal structure of the aromatic oligoamide foldamer binder Affitin C10 fused to a coiled-coil domain | Authors: | Sigl, J.C., Morozov, V., Huc, I. | Deposition date: | 2025-03-06 |
|
PDBID: | 9qdl | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2025-03-06 |
|
PDBID: | 9qdu | Status: | WAIT -- processing started, waiting for author input to continue processing | Title: | KEAP1 complexed to peptide 28 | Authors: | Xinjian, J., Kelvin, L. | Deposition date: | 2025-03-06 | Release date: | 2026-03-06 |
|
PDBID: | 9m61 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Cryo-EM structure of 5-HT2BR in complex with RS127445 | Authors: | Zhong, Y.X., Guo, Q., Tao, Y.Y. | Deposition date: | 2025-03-06 |
|
PDBID: | 9m5w | Status: | HPUB -- hold until publication | Deposition date: | 2025-03-06 |
|
PDBID: | 9m5p | Status: | HPUB -- hold until publication | Title: | I-shaped amyloid fiber (40) of Tottori (D7N) mutant | Authors: | Burton-Smith, R.N., Murata, K. | Deposition date: | 2025-03-06 | Sequence: | >Entity 1 DAEFRHNSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
|
|
PDBID: | 9m5r | Status: | HPUB -- hold until publication | Title: | V''-shaped short pitch amyloid fiber (40) of Tottori (D7N) mutant | Authors: | Burton-Smith, R.N., Murata, K. | Deposition date: | 2025-03-06 | Sequence: | >Entity 1 DAEFRHNSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
|
|
PDBID: | 9m5q | Status: | AUTH -- processed, waiting for author review and approval | Title: | V-shaped amyloid fiber (40) of Tottori (D7N) mutant | Authors: | Burton-Smith, R.N., Murata, K. | Deposition date: | 2025-03-06 |
|
PDBID: | 9m60 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Cryo-EM structure of 5-HT2BR in complex with ritanseirn | Authors: | Zhong, Y.X., Guo, Q., Tao, Y.Y. | Deposition date: | 2025-03-06 |
|
PDBID: | 9m5s | Status: | HPUB -- hold until publication | Deposition date: | 2025-03-06 |
|
PDBID: | 9m5k | Status: | HPUB -- hold until publication | Title: | The cryo-EM structure of in situ amplified (ISA) alpha-synuclein fibrils from PD homogenate | Authors: | Cao, T.Y., Zhao, Q.Y., Liu, C., Li, D. | Deposition date: | 2025-03-06 |
|
PDBID: | 9m5v | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2025-03-06 |
|
PDBID: | 9m5m | Status: | HPUB -- hold until publication | Deposition date: | 2025-03-06 |
|
PDBID: | 9m5n | Status: | HPUB -- hold until publication | Deposition date: | 2025-03-06 |
|
PDBID: | 9m5o | Status: | HPUB -- hold until publication | Deposition date: | 2025-03-06 | Sequence: | >Entity 1 AERENLKNEATKVLEHVCEDINKESYGFVKISKMKENEKEIRLFNLEEIYHSLMKVGGSGATDGGKREDDAASHSVVAESNGAHLLQSDIWVRGRIHDIRSKGSLAFIILRHKLYSMQCILDIKHNDNDKNMMKWVSNLPLESIVDIKGKLSKPEVPIDSTNIKYEAHIRKIFCISKTAKELPFLLKDANMKETNEEGSIKVNQDNRLNNRCVDLRTYANYSIFCLQSQICTIFKNFLLENNFIEIHTPKLLGESSEGGANAFQINYFNQKGFLAQSPQLYKQMCINSGFDRVFEVAPVFRAENSNTYRHLCEYVSLDVEMTYKYDYLENVHFYDSMFKHIFTELSKGGKNEMLIKTVKGQYPCEDFQWLEETPIFTYEEAIKMLIQHGKLHLKEEEILAYDMSTDMEKELGKIVKASHHTDYYIIINFPSALRPFYTMYKEDEPAISNSYDFFMRGEEILSGSQRISDVNLLLENIKRFNLDANKLNFYIDSFAYSSYPHSGCGIGLERVLMLFLGLNNIRKTSLFPRDPKRLIP
|
|
PDBID: | 9m5t | Status: | HPUB -- hold until publication | Title: | Structure of the flagellar filament in short-length at 3.02 angstroms resolution | Authors: | Chen, L.X., Jiang, W.X., Cheng, X.Q., Dong, X., Xing, Q. | Deposition date: | 2025-03-06 |
|
PDBID: | 9m5l | Status: | HPUB -- hold until publication | Title: | The cryo-EM structure of in situ amplified (ISA) alpha-synuclein fibrils from DLB homogenate | Authors: | Cao, T.Y., Zhao, Q.Y., Liu, C., Li, D. | Deposition date: | 2025-03-06 |
|
PDBID: | 9m5u | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Deposition date: | 2025-03-06 |
|
PDBID: | 9m62 | Status: | HOLD -- hold until a certain date | Title: | X-ray Crystal Structure of Pseudoazurin Met16Arg variant, oxidized form at pH 7.0 | Authors: | Nemoto, I., Yamaguchi, T., Kohzuma, T. | Deposition date: | 2025-03-06 | Release date: | 2026-03-06 | Sequence: | >Entity 1 ADFEVHMLNKGKDGARVFEPASLKVAPGDTVTFIPTDKGHNVETIKGMIPDGAEAFKSKINENYKVTFTAPGVYGVKCTPHYGMGMVGVVQVGDAPANLEAVKGAKNPKKAQERLDAALAALGN
|
|
PDBID: | 9m5x | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2025-03-06 |
|
PDBID: | 9m5y | Status: | AUTH -- processed, waiting for author review and approval | Title: | the crystal structure of the Ca2+/CaM-CASK-CaMK complex | Authors: | Li, W., Wang, Y. | Deposition date: | 2025-03-06 |
|
PDBID: | 9m5z | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2025-03-06 |
|
PDBID: | 9nnu | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal Structure of Ebola Envelope glycoprotein GP in complex with compound LD4-189ZbR | Authors: | Agrawal, S., Wilson, I.A. | Deposition date: | 2025-03-06 |
|
PDBID: | 9nnt | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2025-03-06 |
|
PDBID: | 9nny | Status: | AUTH -- processed, waiting for author review and approval | Title: | [4,7,8-2] Shifted tensegrity triangle with an (arm,center,arm) distribution of (4,7,8) base pairs and 2 nt sticky ends, with hexagonal symmetry | Authors: | Abi Rizk, J., Horvath, A., Vecchioni, S., Woloszyn, K., Ohayon, Y.P., Sha, R. | Deposition date: | 2025-03-06 |
|