PDBID: | 8ydr | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-21 |
|
PDBID: | 8yds | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-21 |
|
PDBID: | 8ydq | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-21 |
|
PDBID: | 8ydu | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-21 |
|
PDBID: | 8ydv | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-21 |
|
PDBID: | 8ydw | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-21 |
|
PDBID: | 8ye4 | Status: | HPUB -- hold until publication | Title: | The complex of TCR NYN-I and HLA-A24 bound to SARS-CoV-2 Spike448-456 peptide NYNYLYRLF | Authors: | Deng, S.S., Jin, T.C., Xu, Z.H., Wang, M.H. | Deposition date: | 2024-02-21 |
|
PDBID: | 8s42 | Status: | HPUB -- hold until publication | Title: | Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) and compound 80 (1124898) | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | Deposition date: | 2024-02-21 |
|
PDBID: | 8s4d | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-02-21 |
|
PDBID: | 8s4l | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-21 |
|
PDBID: | 8s4f | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-21 | Sequence: | >Entity 1 MSPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
|
|
PDBID: | 8s4j | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-21 |
|
PDBID: | 8s4i | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-21 |
|
PDBID: | 8s43 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-02-21 |
|
PDBID: | 8s4h | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-21 |
|
PDBID: | 8s4e | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-21 |
|
PDBID: | 8s4k | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-21 |
|
PDBID: | 8s4m | Status: | HPUB -- hold until publication | Title: | Crystal structure of Mycobacterium tuberculosis cytochrome P450 CYP125 in complex with an inhibitor | Authors: | Snee, M., Kavanagh, M., Levy, C. | Deposition date: | 2024-02-21 |
|
PDBID: | 8s4n | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-21 |
|
PDBID: | 8s44 | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-21 |
|
PDBID: | 8s4o | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-21 |
|
PDBID: | 8w2e | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-20 |
|
PDBID: | 8w2f | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-20 |
|
PDBID: | 8w2d | Status: | HPUB -- hold until publication | Title: | holo-PCP-Thioesterase di-domain structure from the sulfazecin biosynthetic nonribosomal peptide synthetase, SulM | Authors: | Patel, K.D., Gulick, A.M. | Deposition date: | 2024-02-20 |
|
PDBID: | 8w2c | Status: | HPUB -- hold until publication | Title: | Thioesterase domain structure from Sulfazecin biosynthetic nonribosomal peptide synthetase SulM | Authors: | Patel, K.D., Gulick, A.M. | Deposition date: | 2024-02-20 |
|