| PDBID: | 9l66 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-24 |
|
| PDBID: | 9l67 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-24 |
|
| PDBID: | 9l6k | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-24 |
|
| PDBID: | 9l68 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human STING in complex with F8W | | Authors: | Feng, Z.W., Zeng, T., Chen, M.R., Xiao, Y.B., Xu, X.L. | | Deposition date: | 2024-12-24 |
|
| PDBID: | 9l6c | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Delta RBD complexed with ConD-852, P2C-1F11 and S304 Fabs | | Authors: | Zheng, Z., Bing, J., Congcong, L., Bing, Z. | | Deposition date: | 2024-12-24 |
|
| PDBID: | 9l6d | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-24 |
|
| PDBID: | 9l63 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | A novel allosteric covalent inhibitory site of fucosyltransferase 8 revealed by crystal structures | | Authors: | Jiang, J., Fang, P. | | Deposition date: | 2024-12-24 |
|
| PDBID: | 9l64 | | Status: | HPUB -- hold until publication | | Title: | A novel allosteric covalent inhibitory site of fucosyltransferase 8 revealed by crystal structures | | Authors: | Jiang, J., Fang, P. | | Deposition date: | 2024-12-24 |
|
| PDBID: | 9l65 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | A novel allosteric covalent inhibitory site of fucosyltransferase 8 revealed by crystal structures | | Authors: | Jiang, J., Fang, P. | | Deposition date: | 2024-12-24 |
|
| PDBID: | 9l6e | | Status: | HPUB -- hold until publication | | Title: | A novel allosteric covalent inhibitory site of fucosyltransferase 8 revealed by crystal structures | | Authors: | Jiang, J., Fang, P. | | Deposition date: | 2024-12-24 |
|
| PDBID: | 9l6a | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of KRas G12D (GDP) in complex with compound 1 | | Authors: | Amano, Y., Tateishi, Y. | | Deposition date: | 2024-12-24 |
|
| PDBID: | 9l6f | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of KRas G12D (GDP) in complex with ASP3082 | | Authors: | Amano, Y., Tateishi, Y. | | Deposition date: | 2024-12-24 |
|
| PDBID: | 9l6j | | Status: | HPUB -- hold until publication | | Title: | Structural studies on the conformation changes induced by ligand binding in an Adenine phosphoribosyltransferase (FnAPRT) from Fusobacterium nucleatum | | Authors: | Kim, B., Hwang, J., Do, H., Lee, J.H. | | Deposition date: | 2024-12-24 |
|
| PDBID: | 9l6m | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of BRD2 BD1 domain in complex with small molecule inhibitor Isoxazole azepine compound. | | Authors: | Jwala, N., Vijayshankar, N., Thomas, A., NarasimhaRao, K. | | Deposition date: | 2024-12-24 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMSNPKKPGRVTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMDMGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVLMAQTLEKIFLQKVASMPQEEQELVVTIPKNSHKKGA
|
|
| PDBID: | 9l6n | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | PEDV 3CLpro mutant (C144A) in complex with nsp5/6 peptite substrate | | Authors: | Zhang, Y., Zhang, D., Shi, Y.J., Peng, G.Q. | | Deposition date: | 2024-12-24 | | Release date: | 2025-12-24 |
|
| PDBID: | 9l6p | | Status: | HPUB -- hold until publication | | Title: | Cryo-electron microscopic structure of a highly efficient ochratoxin detoxification enzyme LlADH | | Authors: | Dai, L.H., Xu, Y.H., Hu, Y.M., Niu, D., He, B.Y., Huang, J.P., Xie, Z.Z., Li, H., Guo, R.-T., Chen, C.-C. | | Deposition date: | 2024-12-24 |
|
| PDBID: | 9l5h | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-12-23 |
|
| PDBID: | 9mnv | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-12-23 |
|
| PDBID: | 9mnp | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of mutant variant of mAb CV3-25 Fab in complex with SARS-CoV-2 spike stem helix peptide | | Authors: | Chandravanshi, M., Tolbert, W.D., Pazgier, M. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 9mno | | Status: | HPUB -- hold until publication | | Title: | Structure of the TelA-associated type VII secretion system chaperone LcpA in complex with the chaperone binding site of TelA | | Authors: | Garrett, S.R., Kim, Y., Whitney, J.C. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 9mnr | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-12-23 | | Release date: | 2025-12-23 |
|
| PDBID: | 9mnq | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of Hepatitis C Virus Envelope Glycoprotein E2 core from genotype 6a bound to broadly neutralizing antibody RM10-30 | | Authors: | Nguyen, T.K.Y., Wilson, I.A. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 9mnt | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of Hepatitis C Virus Envelope Glycoprotein E2 core from genotype 6a bound to broadly neutralizing antibody RM1-73 | | Authors: | Nguyen, T.K.Y., Stanfield, R.L., Wilson, I.A. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 9mns | | Status: | HPUB -- hold until publication | | Title: | Structure of Hepatitis C Virus Envelope Glycoprotein E2 core from genotype 6a bound to broadly neutralizing antibody RM1-36 | | Authors: | Nguyen, T.K.Y., Stanfield, R.L., Wilson, I.A. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 9mnu | | Status: | HPUB -- hold until publication | | Title: | Structure of Hepatitis C Virus Envelope Glycoprotein E2 core from genotype 6a bound to broadly neutralizing antibody RM11-48 | | Authors: | Nguyen, T.K.Y., Stanfield, R.L., Wilson, I.A. | | Deposition date: | 2024-12-23 |
|
