| PDBID: | 8wpl | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-10 |
|
| PDBID: | 8wpm | | Status: | HPUB -- hold until publication | | Title: | Structure of a TRP channel complex, antagonist-bound state | | Authors: | Won, J., Jeong, H., Lee, H.H. | | Deposition date: | 2023-10-10 |
|
| PDBID: | 8wpn | | Status: | HPUB -- hold until publication | | Title: | Structure of a TRP channel | | Authors: | Won, J., Jeong, H., Lee, H.H. | | Deposition date: | 2023-10-10 |
|
| PDBID: | 8wph | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-10 |
|
| PDBID: | 8wpx | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-10-10 |
|
| PDBID: | 8wpw | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-10 |
|
| PDBID: | 8wpy | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-10 |
|
| PDBID: | 8qrj | | Status: | HPUB -- hold until publication | | Title: | LCC-ICCG PETase mutant H218Y | | Authors: | Orr, G., Niv, Y., Barakat, M., Boginya, A., Dessau, M., Afriat-Jurnou, L. | | Deposition date: | 2023-10-09 | | Sequence: | >Entity 1
MDGVLWRVRTAALMAALLALAAWALVWASPSVEAQSNPYQRGPNPTRSALTADGPFSVATYTVSRLSVSGFGGGVIYYPTGTSLTFGGIAMSPGYTADASSLAWLGRRLASHGFVVLVINTNSRFDGPDSRASQLSAALNYLRTSSPSAVRARLDANRLAVAGHSMGGGGTLRIAEQNPSLKAAVPLTPWHTDKTFNTSVPVLIVGAEADTVAPVSQYAIPFYQNLPSTTPKVYVELCNASHIAPNSNNAAISVYTISWMKLWVDNDTRYRQFLCNVNDPALCDFRTNNRHCQ
|
|
| PDBID: | 8qrz | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-09 |
|
| PDBID: | 8uht | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-09 |
|
| PDBID: | 8uhs | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-09 |
|
| PDBID: | 8uhp | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2023-10-09 |
|
| PDBID: | 8uhn | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-09 |
|
| PDBID: | 8uhj | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-09 |
|
| PDBID: | 8uhh | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-09 |
|
| PDBID: | 8uhk | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-09 |
|
| PDBID: | 8uhx | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-09 |
|
| PDBID: | 8uhy | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-09 |
|
| PDBID: | 8wp6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-09 |
|
| PDBID: | 8wpd | | Status: | HPUB -- hold until publication | | Title: | Complex structure of AtHPPD with YH20009 | | Authors: | Yang, G.-F., Lin, H.-Y., Dong, J. | | Deposition date: | 2023-10-09 |
|
| PDBID: | 8wpc | | Status: | HPUB -- hold until publication | | Title: | Complex structure of AtHPPD with LB553 | | Authors: | Yang, G.-F., Lin, H.-Y., Dong, J. | | Deposition date: | 2023-10-09 |
|
| PDBID: | 8wp7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-09 |
|
| PDBID: | 8wpa | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-09 |
|
| PDBID: | 8uhc | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-08 |
|
| PDBID: | 8wp1 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of SUCR1 in complex with cis-epoxysuccinic acid and Gi proteins | | Authors: | Liu, A., Ye, R.D. | | Deposition date: | 2023-10-08 |
|
