PDBID: | 9cur | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-26 |
|
PDBID: | 9cul | Status: | HOLD -- hold until a certain date | Deposition date: | 2024-07-26 | Release date: | 2025-07-26 | Sequence: | >Entity 1 MQNGDFQILDYTGLISTMPRVDTLLQSMNLFTEHFGRTTVARIERLDDGAGDIKAVQRGGVRQHLANDRKKIVNLNIPFFPLDRSIDRADIQNFREFGTENAPATVDAEVQRHMARIRRSHAILKSKAMYAALKGTSWSPDDPVSDYNYYDVWGATQTTADVDFTKLGVDPIEVLEAEARAHIIDWAGDNGDNYEIVVLASRQWFSALIAHPQVTGAYSQYPSTQEILRRRLGGNANNRIFEHKNILFIEDISGNIPAGEAYIFPRGISRMFEIYYAPSDTLRDANQAAQELYVFFKESNYLREAKIESETSFLTVNNRPELVVKSTGKFTA
>Entity 2 MAKAHVATLEGNYSDIVLGRVVAFGDTGWNFKEVDMTFIADDADADSKTTLFAGVLVGEDGTPATAAAGVFGVLVDRKVLPGVDHYIGVFEPGEKVPMVLAVRGLTLNQLKLKYADGTAIDAAGIQALEAQGNQVTDKIVGTQFIGSVL
|
|
PDBID: | 9cum | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-07-26 |
|
PDBID: | 9cuq | Status: | WAIT -- processing started, waiting for author input to continue processing | Title: | Crystal structure of HCV E2 hypervariable region 1 peptide in complex with bound antibody | Authors: | Mian, M.I., Janus, B.M., Ofek, G.O. | Deposition date: | 2024-07-26 |
|
PDBID: | 9cuv | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-26 |
|
PDBID: | 9cut | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-26 |
|
PDBID: | 9cuj | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-26 |
|
PDBID: | 9cuk | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-26 |
|
PDBID: | 9cuh | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-26 |
|
PDBID: | 9cui | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-26 |
|
PDBID: | 9cua | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-07-26 |
|
PDBID: | 9cun | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-26 |
|
PDBID: | 9cub | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-07-26 |
|
PDBID: | 9cug | Status: | HPUB -- hold until publication | Title: | X-ray Structure of human Interferon Regulatory Factor 4 (IRF4) IAD Domain | Authors: | Seo, H.-S., Agius, M.P., Dhe-Paganon, S. | Deposition date: | 2024-07-26 |
|
PDBID: | 9cuf | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Title: | Room temperature SSX structure of ccNiR | Authors: | Malla, T.N., Schmidt, M. | Deposition date: | 2024-07-26 |
|
PDBID: | 9cuc | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-07-26 |
|
PDBID: | 9cud | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-07-26 |
|
PDBID: | 9cue | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-07-26 |
|
PDBID: | 9cux | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal Structure of SETDB1 Tudor domain in complex with UNC100016 | Authors: | Silva, M., Dong, A., Arrowsmith, C.H., Edwards, A.M., Halabelian, L., Structural Genomics Consortium (SGC) | Deposition date: | 2024-07-26 |
|
PDBID: | 9cuw | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal Structure of SETDB1 Tudor domain in complex with UNC100013 | Authors: | Silva, M., Dong, A., Arrowsmith, C.H., Edwards, A.M., Halabelian, L., Structural Genomics Consortium (SGC) | Deposition date: | 2024-07-26 |
|
PDBID: | 9cuu | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-26 |
|
PDBID: | 9cuy | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-26 |
|
PDBID: | 9cu8 | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-26 |
|
PDBID: | 9cup | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-07-26 |
|
PDBID: | 9g9l | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-25 |
|