| PDBID: | 8xug | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of AtHPPD-YH21831 complex | | Authors: | Dong, J., Lin, H.-Y., Yang, G.-F. | | Deposition date: | 2024-01-12 |
|
| PDBID: | 8xu3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-12 |
|
| PDBID: | 8xuc | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of AtHPPD + ZJ-1 complex | | Authors: | Dong, J., Lin, H.-Y., Yang, G.-F. | | Deposition date: | 2024-01-12 |
|
| PDBID: | 8xtw | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-12 |
|
| PDBID: | 8xu6 | | Status: | HOLD -- hold until a certain date | | Title: | Study on zinc finger structure and function of tumor suppressor ZMYND11 | | Authors: | Bai, X., Chen, Z., Chen, Z. | | Deposition date: | 2024-01-12 | | Release date: | 2025-01-12 |
|
| PDBID: | 8xuf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-12 |
|
| PDBID: | 8rnz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-11 |
|
| PDBID: | 8ro3 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Cryo-EM structure of the staked Photosystem II - LHCII supercomplex from Chlorella ohadi | | Authors: | Fadeeva, M., Klaiman, D., Caspy, I., Nelson, N. | | Deposition date: | 2024-01-11 |
|
| PDBID: | 8ro5 | | Status: | HPUB -- hold until publication | | Title: | HLA-A3 restricted mG12V-TCR | | Authors: | Sim, M.J.W., Sun, P.D. | | Deposition date: | 2024-01-11 |
|
| PDBID: | 8vl6 | | Status: | HPUB -- hold until publication | | Title: | HcG in complex within mini protein | | Authors: | Baohua, C., Rongsheng, J. | | Deposition date: | 2024-01-11 |
|
| PDBID: | 8vl1 | | Status: | HPUB -- hold until publication | | Title: | Escherichia coli transcription-translation loosely coupled complex (TTC-LC) containing mRNA with a 36 nt long spacer, ops signal, RfaH, NusA, and fMet-tRNAs in E-site and P-site | | Authors: | Molodtsov, V., Wang, C., Ebright, R.H. | | Deposition date: | 2024-01-11 |
|
| PDBID: | 8vla | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-11 |
|
| PDBID: | 8vle | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-01-11 |
|
| PDBID: | 8vld | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-11 |
|
| PDBID: | 8vlf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-11 |
|
| PDBID: | 8vlh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-11 |
|
| PDBID: | 8vln | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-11 |
|
| PDBID: | 8vlo | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-11 |
|
| PDBID: | 8vlp | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-11 |
|
| PDBID: | 8vl2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-11 |
|
| PDBID: | 8vl5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-11 |
|
| PDBID: | 8xtl | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-11 |
|
| PDBID: | 8xtt | | Status: | HOLD -- hold until a certain date | | Title: | Nuclear receptor Nor1 ligand binding domain | | Authors: | Yoo, J.Y., Yoon, H.S. | | Deposition date: | 2024-01-11 | | Release date: | 2025-01-11 | | Sequence: | >Entity 1
KSPLQQEPSQPSPPSPPICMMNALVRALTDSTPRDLDYSRYCPTDQAAAGTDAEHVQQFYNLLTASIDVSRSWAEKIPGFTDLPKEDQTLLIESAFLELFVLRLSIRSNTAEDKFVFCNGLVLHRLQCLRGFGEWLDSIKDFSLNLQSLNLDIQALACLSALSMITERHGLKEPKRVEELCNKITSSLKDHQSKGQALEPTESKVLGALVELRKICTLGLQRIFYLKLEDLVSPPSIIDKLFLDTLPF
|
|
| PDBID: | 8xto | | Status: | HOLD -- hold until a certain date | | Title: | Human Keratin 19 head domain segment L18-G38 in solution | | Authors: | Jeong, M., Ji, Y., Kim, J., Lee, C.H. | | Deposition date: | 2024-01-11 | | Release date: | 2025-01-11 | | Sequence: | >Entity 1
LGGGSVRFGPGVAFRAPSIHG
|
|
| PDBID: | 8xtn | | Status: | HOLD -- hold until a certain date | | Title: | Human Keratin 19 head domain segment Y6-G38 in solution | | Authors: | Jeong, M., Ji, Y., Kim, J., Lee, C.H. | | Deposition date: | 2024-01-11 | | Release date: | 2025-01-11 | | Sequence: | >Entity 1
YRQSSATSSFGGLGGGSVRFGPGVAFRAPSIHG
|
|
