| PDBID: | 9vf4 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9ver | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9vet | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9vev | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9vfb | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9veq | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Keap1 in complex with a small molecule inhibitor, KMN003 | | Authors: | Ishida, H., Osawa, M. | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9vf5 | | Status: | PROC -- to be processed | | Title: | Cryo-EM structure of apo form of Arthrobacter psychrolactophillus L-arabinose isomerase | | Authors: | Laksmi, F.A., Nugraha, Y., Jayawardena, N., Raschdorf, O., chek, M., Kohga, H., Herliana, L., Fathoni, A., Hidayat, I. | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9vey | | Status: | HOLD -- hold until a certain date | | Title: | Ethanol dehydrogenase of Pseudomonas syringae pv. actinidiae | | Authors: | Li, X.Y., Luo, X., Zhang, S.Q., Xing, Z.F. | | Deposition date: | 2025-06-10 | | Release date: | 2026-06-10 |
|
| PDBID: | 9vf2 | | Status: | PROC -- to be processed | | Title: | Spirooxindole inhibitor CG-1059 complexed with SARS-Cov-2 3CL protease | | Authors: | Tang, X., Chen, X., Hou, K., Fan, W. | | Deposition date: | 2025-06-10 | | Release date: | 2026-06-10 |
|
| PDBID: | 9vf3 | | Status: | PROC -- to be processed | | Title: | Spirooxindole inhibitor CG-1062 complexed with SARS-Cov-2 3CL protease | | Authors: | Tang, X., Chen, X., Hou, K., Fan, W. | | Deposition date: | 2025-06-10 | | Release date: | 2026-06-10 |
|
| PDBID: | 9veu | | Status: | HPUB -- hold until publication | | Title: | Structure of the magnesium channel CorA from Mycobacterium tuberculosis in the presence of Mg2+ | | Authors: | Chen, X., Li, M. | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9vf6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9p1q | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Ube2E3 | | Authors: | Cook, M.W., Brzovic, P.S., Stenkamp, R.E. | | Deposition date: | 2025-06-10 | | Sequence: | >Entity 1
MTSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSSDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYLTNRAEHDRIARQWTKRYAT
|
|
| PDBID: | 9p1k | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of sensory domain of CdgA from Vibrio cholerae O1 biovar El Tor str. N16961 | | Authors: | Marceau, A.H., Mariscal, V.T., Tripathi, S.M., Yildiz, F.H., Rubin, S.M. | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9p1l | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9p1h | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | 100K human S-adenosylmethionine decarboxylase | | Authors: | Patel, J.R., Bonzon, T.J., Bahkt, T., Faghobun, O.O., Clinger, J.A. | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9p1v | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structural of MAb PhtD3 in complex with PhtD | | Authors: | Du, J., Cui, J., Lin, Z., Eisenhauer, J., Pallesen, J., Weiner, D.B. | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9p1p | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the apo form of CLZ9 from Streptomyces | | Authors: | Sirohi, H.V., Kao, Y.C., Chang, G. | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9p1r | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of TCZ9 from Streptomyces | | Authors: | Sirohi, H.V., Kao, Y.C., Chang, G. | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9p1j | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Staphylococcus aureus ClpP in complex with chimerabactin | | Authors: | Lee, R.E., Griffith, E.C. | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9p1n | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9p1o | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of TCZ9 bound with Cannabigerolic acid (CBGA) | | Authors: | Sirohi, H.V., Kao, Y.C., Chang, G. | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9p1i | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Atomic structure of vibrio effector fragment VopV bound to Beta-cytoplasmic/gamma1-cytoplasmic F-actin | | Authors: | Kreutzberger, M.A., Kudryashova, E., Egelman, E.H., Kudryashov, D.S. | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9p1s | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9p1m | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-06-10 |
|
