| PDBID: | 9r1t | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Deposition date: | 2025-04-28 |
|
| PDBID: | 9r1s | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of an NtA622L variant in complex with NADPH and Nicotinic acid N-glucoside | | Authors: | Mokos, D., Daniel, B. | | Deposition date: | 2025-04-28 |
|
| PDBID: | 9r1z | | Status: | HPUB -- hold until publication | | Title: | Keap1 - inhibitor complex - 3 | | Authors: | Talapatra, S.K., Kozielski, F., Wells, G. | | Deposition date: | 2025-04-28 |
|
| PDBID: | 9r1p | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-04-28 | | Release date: | 2026-04-28 |
|
| PDBID: | 9up3 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Ebola virus VP30 and its peptide NPL3 | | Authors: | Wu, F., Xu, W. | | Deposition date: | 2025-04-27 |
|
| PDBID: | 9up4 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Ebola virus VP30 and its peptide RPL1 | | Authors: | Wu, F., Xu, W. | | Deposition date: | 2025-04-27 |
|
| PDBID: | 9uox | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-27 |
|
| PDBID: | 9uoy | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-27 |
|
| PDBID: | 9up2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-27 |
|
| PDBID: | 9uoz | | Status: | HPUB -- hold until publication | | Title: | Structure of Echinococcus multilocularis Cystatin B | | Authors: | Huang, S.Q., Hong, W.B. | | Deposition date: | 2025-04-27 |
|
| PDBID: | 9uow | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-27 |
|
| PDBID: | 9up7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-27 |
|
| PDBID: | 9up5 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-27 |
|
| PDBID: | 9up6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-27 |
|
| PDBID: | 9up1 | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2025-04-27 |
|
| PDBID: | 9up8 | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2025-04-27 |
|
| PDBID: | 9up0 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-27 |
|
| PDBID: | 9odt | | Status: | HPUB -- hold until publication | | Title: | The structure of a Bacterial Cyanide Dihydratase from Bacillus safensis PER-URP-08 | | Authors: | Justo Arevalo, S., Valle-Riestra F, V., Balan, A., Chuck, C.S. | | Deposition date: | 2025-04-27 | | Sequence: | >Entity 1
MTSIYPKFRAAAVQAAPVYLNLEATVEKSCELIDEAASNGAKLVAFPEAFLPGYPWFAFIGHPEYTRKFYHELYKNAVEIPSLAIQKISEAAKRNETYVCISCSEKDGGSLYLAQLWFNPNGDLIGKHRKMRASVAERLIWGDGSGSMMPVFQTDIGNLGGLMCWEHQVPLDLMAMNAQNEQVHVASWPGYFDDEISSRYYAIATQTFVLMTSSIYTEEMKEMICLTQEQRDYFETFKSGHTCIYGPDGEPISDMVPAETEGIAYAEIDVERVIDYKYYIDPAGHYSNQSLSMNFNQQPTPVVKQLYHQKNEVFTYEDIQYQHGILEEKV
|
|
| PDBID: | 9odd | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Pasteurella multocida surface lipoprotein PmSLP-3 in complex with bovine complement component C4c and factor I | | Authors: | Nguyen, Q.H., Moraes, T.F. | | Deposition date: | 2025-04-27 |
|
| PDBID: | 9odc | | Status: | HPUB -- hold until publication | | Title: | Pasteurella multocida surface lipoprotein PmSLP-3 in complex with bovine complement component C3c and factor I | | Authors: | Nguyen, Q.H., Moraes, T.F. | | Deposition date: | 2025-04-27 |
|
| PDBID: | 9odq | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-27 |
|
| PDBID: | 9ode | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-27 |
|
| PDBID: | 9odf | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-27 |
|
| PDBID: | 9odg | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-27 |
|
| PDBID: | 9odh | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-27 |
|
