| PDBID: | 9e5s | | Status: | HPUB -- hold until publication | | Title: | env2 cobalamin riboswitch aptamer domain in complex with ethynyl-4-(4-phenyl-2,3,4-triazole)-propanamine-cobalamin | | Authors: | Olenginski, L.T., Zeps, N.J., Batey, R.T. | | Deposition date: | 2024-10-28 |
|
| PDBID: | 9e5t | | Status: | HPUB -- hold until publication | | Title: | env2 cobalamin riboswitch aptamer domain in complex with ethynyl-4-(4-phenyl-2,3,4-triazole)-guanidinium-cobalamin | | Authors: | Olenginski, L.T., Zep, N.J., Batey, R.T. | | Deposition date: | 2024-10-28 |
|
| PDBID: | 9e5u | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-28 |
|
| PDBID: | 9e5a | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-28 |
|
| PDBID: | 9h7w | | Status: | HPUB -- hold until publication | | Title: | Hen Egg White Lysozyme in Complex with Imidizole | | Authors: | Bauer, J.A., Bauerova, V. | | Deposition date: | 2024-10-28 |
|
| PDBID: | 9h7u | | Status: | HPUB -- hold until publication | | Title: | Hexagonally Ordered Nanofibrils Easily Yield by dual Amphiphilic Self-Assembling Peptide | | Authors: | Mazzotta, F., Baptista, L.A., Schmidt, M., Gacanin, J., Lieberwirth, I., Weil, T., Landfester, K. | | Deposition date: | 2024-10-28 |
|
| PDBID: | 9h7q | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-28 |
|
| PDBID: | 9h84 | | Status: | HPUB -- hold until publication | | Title: | BAM-hinge (LVPR) | | Authors: | Machin, J.M., Ranson, N.A. | | Deposition date: | 2024-10-28 |
|
| PDBID: | 9h7r | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-28 |
|
| PDBID: | 9h7t | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-28 |
|
| PDBID: | 9h7z | | Status: | HPUB -- hold until publication | | Title: | Aspergillus niger Glucose Oxidase bound to Ba2+ ions | | Authors: | Bauer, J.A., Bauerova, V. | | Deposition date: | 2024-10-28 |
|
| PDBID: | 9h7v | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-28 |
|
| PDBID: | 9h81 | | Status: | HPUB -- hold until publication | | Title: | human carbonic anhydrase I in complex with Sonepiprazole | | Authors: | Angeli, A., Ferraroni, M. | | Deposition date: | 2024-10-28 | | Sequence: | >Entity 1
MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
|
|
| PDBID: | 9h85 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-28 |
|
| PDBID: | 9h89 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-28 |
|
| PDBID: | 9k9p | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-27 |
|
| PDBID: | 9k9q | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-27 |
|
| PDBID: | 9k9o | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of OsSPS3 complexed with isopentenyl thiolodiphosphate | | Authors: | Xiao, H., Li, M., Yang, G.-F. | | Deposition date: | 2024-10-27 |
|
| PDBID: | 9k9n | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of MjHKU4r-CoV-1 receptor-binding domain complexed with human CD26 | | Authors: | Sun, J.Q. | | Deposition date: | 2024-10-27 |
|
| PDBID: | 9e53 | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Crystal structure of the A/Puerto Rico/8/1934 (H1N1) influenza virus hemagglutinin in complex with cyclic peptide iHA-100 | | Authors: | Nguyen, T.K.Y., Wilson, I.A. | | Deposition date: | 2024-10-27 |
|
| PDBID: | 9e54 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the A/Puerto Rico/8/1934 (H1N1) influenza virus hemagglutinin in complex with cyclic peptide L2 | | Authors: | Nguyen, T.K.Y., Wilson, I.A. | | Deposition date: | 2024-10-27 |
|
| PDBID: | 9e55 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the A/Viet Nam/1203/2004(H5N1) influenza virus hemagglutinin in complex with cyclic peptide iHA-100 | | Authors: | Nguyen, T.K.Y., Wilson, I.A. | | Deposition date: | 2024-10-27 |
|
| PDBID: | 9h79 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Thrombin in complex with a Chlorothiophene-based inhibitor, CP2, discovered by a novel rapid nanoscale library screening. | | Authors: | Chinellato, M., Zsolt, B., Angelini, A., Heinis, C., Cendron, L. | | Deposition date: | 2024-10-27 |
|
| PDBID: | 9k9g | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-26 |
|
| PDBID: | 9k9a | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of OsSPS3 complexed with YH231275 | | Authors: | Xiao, H., Li, M., Yang, G.-F. | | Deposition date: | 2024-10-26 |
|
