| PDBID: | 9kp3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-22 |
|
| PDBID: | 9kp4 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human CASTOR1 in apo form | | Authors: | Liu, C., Ding, J., Zhang, T. | | Deposition date: | 2024-11-22 |
|
| PDBID: | 9kpb | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human CASTOR2 in apo form | | Authors: | Liu, C., Ding, J., Zhang, T. | | Deposition date: | 2024-11-22 |
|
| PDBID: | 9kpg | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human CASTOR2-arginine | | Authors: | Liu, C., Ding, J., Zhang, T. | | Deposition date: | 2024-11-22 |
|
| PDBID: | 9kpk | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-22 |
|
| PDBID: | 9ehf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-22 |
|
| PDBID: | 9ehg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-22 |
|
| PDBID: | 9eha | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-22 |
|
| PDBID: | 9ehd | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-22 |
|
| PDBID: | 9ehc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-22 |
|
| PDBID: | 9eh9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-22 |
|
| PDBID: | 9ehe | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-22 |
|
| PDBID: | 9ehh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-22 |
|
| PDBID: | 9ehb | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-22 |
|
| PDBID: | 9hhj | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-11-21 | | Release date: | 2025-11-21 |
|
| PDBID: | 9hhh | | Status: | HPUB -- hold until publication | | Title: | A rare open conformation for Ubl2 domain of papain-like protease C111S of SARS-CoV2 | | Authors: | Freiherr von Scholley, G.L., Schaefer, M., Soler Lopez, M., Hillig, R., Mueller-Dieckmann, C., Kandiah, E. | | Deposition date: | 2024-11-21 | | Sequence: | >Entity 1
EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNSYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYKENSYTTTIKPENLYFQ
|
|
| PDBID: | 9hhg | | Status: | HPUB -- hold until publication | | Title: | A rare open conformation for Ubl2 domain of papain-like protease of SARS-CoV2 | | Authors: | Freiherr von Scholley, G.L., Schaefer, M., Soler Lopez, M., Hillig, R., Mueller-Dieckmann, C., Kandiah, E. | | Deposition date: | 2024-11-21 | | Sequence: | >Entity 1
EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYKENSYTTTIKPENLYFQ
|
|
| PDBID: | 9hhi | | Status: | HPUB -- hold until publication | | Title: | A rare open conformation for Ubl2 domain of papain-like protease without zinc of SARS-CoV2 | | Authors: | Freiherr von Scholley, G.L., Schaefer, M., Soler Lopez, M., Hillig, R., Mueller-Dieckmann, C., Kandiah, E. | | Deposition date: | 2024-11-21 | | Sequence: | >Entity 1
EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYKENSYTTTIKPENLYFQ
|
|
| PDBID: | 9hhe | | Status: | HPUB -- hold until publication | | Title: | Structure of the Ist2 TMEM16 homology domain in the detergent GDN | | Authors: | Arndt, M., Dutzler, R. | | Deposition date: | 2024-11-21 |
|
| PDBID: | 9hh9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-21 |
|
| PDBID: | 9hhl | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-21 |
|
| PDBID: | 9hhf | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-11-21 |
|
| PDBID: | 9hhk | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human TRF1 TRFH domain in complex with compound 2 | | Authors: | Casale, G., Le Bihan, Y.-V., Van Montfort, R.L.M., Guettler, S. | | Deposition date: | 2024-11-21 | | Sequence: | >Entity 1
SNAQVQVGAPEEEEEEEEDAGLVAEAEAVAAGWMLDFLCLSLCRAFRDGRSEDFRRTRNSAEAIIHGLSSLTACQLRTIYICQFLTRIAAGKTLDAQFENDERITPLESALMIWGSIEKEHDKLHEEIQNLIKIQAIAVCMENGNFKEAEEVFERIFGDPNSHMPFKSKLLMIISQKDTFHSFFQHFSYNHMMEKIKSYVNYVLSEKSSTFLMKAAAKVVESKR
|
|
| PDBID: | 9koq | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-21 |
|
| PDBID: | 9kou | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-21 |
|
