| PDBID: | 8zbc | | Status: | HPUB -- hold until publication | | Title: | An acyltransferase with selective perhydrolytic activity | | Authors: | Yin, Z., Jing, W. | | Deposition date: | 2024-04-26 |
|
| PDBID: | 8zbk | | Status: | HPUB -- hold until publication | | Title: | Mouse left ventricle ATM complex | | Authors: | Li, D.N., Zhao, Q.Y., Liu, C. | | Deposition date: | 2024-04-26 |
|
| PDBID: | 8zbn | | Status: | HPUB -- hold until publication | | Title: | Mouse MYH6 R404Q left ventricle ATM complex | | Authors: | Li, D.N., Zhao, Q.Y., Liu, C. | | Deposition date: | 2024-04-26 |
|
| PDBID: | 8zbh | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of TEAD3 YAP binding domain with compound 3 | | Authors: | Yoo, Y., Kim, H. | | Deposition date: | 2024-04-26 |
|
| PDBID: | 8zbj | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-26 |
|
| PDBID: | 8zbg | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of TEAD3 YAP binding domain with compound 15 | | Authors: | Yoo, Y., Kim, H. | | Deposition date: | 2024-04-26 |
|
| PDBID: | 9bk0 | | Status: | HPUB -- hold until publication | | Title: | TEM-1 WT in complex with BLIP E73W | | Authors: | Rivera, P., Lu, S., Sankaran, B., Prasad, B.V.V., Palzkill, T.G. | | Deposition date: | 2024-04-26 |
|
| PDBID: | 9bjz | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2024-04-26 |
|
| PDBID: | 9f4b | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-04-26 |
|
| PDBID: | 9f4a | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-26 |
|
| PDBID: | 9f3v | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-26 |
|
| PDBID: | 9f46 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-26 |
|
| PDBID: | 9f3u | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-26 |
|
| PDBID: | 9f47 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-26 |
|
| PDBID: | 9f49 | | Status: | HOLD -- hold until a certain date | | Title: | Structure of the bacteriophage K gp155 C-terminal domain, seleno-methionine modified version | | Authors: | Pichel, A., van Raaij, M.J. | | Deposition date: | 2024-04-26 | | Release date: | 2024-06-21 | | Sequence: | >Entity 1
KDF(MSE)LIGHRGATGYTDEHTIKGYQ(MSE)ALDKGADYIELDLQLTKDNKLLC(MSE)HDSTIDRTTTGTGKVGD(MSE)TLSYIQTNFTSLNGEPIPSLDDVLNHFGTKVKYYIETKRPFDAN(MSE)DRELLTQLKAKGLIGIGSERFQVIIQSFARESLINIHNQFSNIPLAYLTSTFSESE(MSE)DDCLSYGFYAIAPKYTTITKELVDLAHSKGLKVHAWTVNTKEE(MSE)QSLIQ(MSE)GVDGFFTNYLDEYKKI
|
|
| PDBID: | 8zac | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-25 |
|
| PDBID: | 8zad | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-25 |
|
| PDBID: | 8zae | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-25 |
|
| PDBID: | 8zaf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-25 |
|
| PDBID: | 8zag | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-25 |
|
| PDBID: | 8zaj | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-25 |
|
| PDBID: | 8zai | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-25 |
|
| PDBID: | 8zal | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-25 |
|
| PDBID: | 8zar | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-04-25 |
|
| PDBID: | 8zas | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-25 |
|
