| PDBID: | 9f7i | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Borrelia burgdorferi B31 CspZ in complex with human FH SCR6-7 | | Authors: | Brangulis, K., Surth, V., Marcinkiewicz, A.L., Akopjana, I., Kazaks, A., Bogans, J., Huber, A., Lin, Y.-P., Kraiczy, P. | | Deposition date: | 2024-05-03 |
|
| PDBID: | 9f73 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-03 |
|
| PDBID: | 9f74 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-03 |
|
| PDBID: | 9f75 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-03 |
|
| PDBID: | 9f76 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-03 |
|
| PDBID: | 9f77 | | Status: | HPUB -- hold until publication | | Title: | BAZ2A bromodomain in complex with acetylpyrrole derivative compound 27-TND19 | | Authors: | Dalle Vedove, A., Cazzanelli, G., Caflisch, A., Lolli, G. | | Deposition date: | 2024-05-03 |
|
| PDBID: | 9f78 | | Status: | HPUB -- hold until publication | | Title: | BAZ2A bromodomain in complex with acetylpyrrole derivative compound 28-TN23 | | Authors: | Dalle Vedove, A., Cazzanelli, G., Caflisch, A., Lolli, G. | | Deposition date: | 2024-05-03 |
|
| PDBID: | 9f7g | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-03 |
|
| PDBID: | 9f7k | | Status: | HPUB -- hold until publication | | Title: | Glutathione transferase epsilon 1 from Drosophila melanogaster in complex with glutathione | | Authors: | Didierjean, C., Schwartz, M., Neiers, F. | | Deposition date: | 2024-05-03 | | Sequence: | >Entity 1
MSSSGIVLYGTDLSPCVRTVKLTLKVLNLDYEYKEVNLQAGEHLSEEYVKKNPQHTVPMLDDNGTFIWDSHAIAAYLVDKYAKSDELYPKDLAKRAIVNQRLFFDASVIYASIANVSRPFWINGVTEVPQEKLDAVHQGLKLLETFLGNSPYLAGDSLTLADLSTGPTVSAVPAAVDIDPATYPKVTAWLDRLNKLPYYKEINEAPAQSYVAFLRSKWTKLGDK
|
|
| PDBID: | 9f7j | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-03 |
|
| PDBID: | 9f7b | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-03 |
|
| PDBID: | 8zds | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-03 |
|
| PDBID: | 8zdt | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-03 |
|
| PDBID: | 8zdu | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-03 |
|
| PDBID: | 8zdr | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-03 |
|
| PDBID: | 8zdz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-03 |
|
| PDBID: | 8zdw | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-03 |
|
| PDBID: | 8zdx | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of MjHKU4r-CoV-1 RBD bound to hDPP4 | | Authors: | Yang, M., Li, Z., Xu, Y., Zhang, S. | | Deposition date: | 2024-05-03 |
|
| PDBID: | 8zdv | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-03 |
|
| PDBID: | 8zdy | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-03 |
|
| PDBID: | 9bnt | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-03 |
|
| PDBID: | 9bny | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-03 |
|
| PDBID: | 9bo1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-03 |
|
| PDBID: | 9bo2 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-03 |
|
| PDBID: | 9bo4 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-03 |
|
