| PDBID: | 7h69 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | THE 1.67 A CRYSTAL STRUCTURE OF HUMAN CHYMASE IN COMPLEX WITH 1-[(7-fluoronaphthalen-1-yl)methyl]indole-2-carboxylic acid | | Authors: | Banner, D.W., Benz, J.M., Schlatter, D., Hilpert, H. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 7h6a | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | THE 1.68 A CRYSTAL STRUCTURE OF HUMAN CHYMASE IN COMPLEX WITH 3-[2-(dimethylamino)-2-oxoethyl]-5-fluoro-1-(naphthalen-1-ylmethyl)indole-2-carboxylic acid (2-carboxy indole) | | Authors: | Banner, D.W., Benz, J.M., Schlatter, D., Hilpert, H. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 7h6b | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | THE 2.17 A CRYSTAL STRUCTURE OF HUMAN CHYMASE IN COMPLEX WITH methyl 4-[(5-fluoro-3-methyl-1-benzothiophen-2-yl)sulfonylamino]-3-methylsulfonylbenzoate (TOA EIYO INHIBITOR) | | Authors: | Banner, D.W., Benz, J.M., Schlatter, D., Hilpert, H. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 7h6c | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | THE 1.60 A CRYSTAL STRUCTURE OF HUMAN CHYMASE IN COMPLEX WITH 1-(2-methoxyethyl)-3-(naphthalen-1-ylmethyl)indole-2-carboxylic acid | | Authors: | Banner, D.W., Benz, J.M., Schlatter, D., Hilpert, H. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 7h6d | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | THE 1.64 A CRYSTAL STRUCTURE OF HUMAN CHYMASE IN COMPLEX WITH 1-[(8-methylnaphthalen-1-yl)methyl]indole-2-carboxylic acid | | Authors: | Banner, D.W., Benz, J.M., Schlatter, D., Hilpert, H. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 7h6e | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | THE 2.0 A CRYSTAL STRUCTURE OF HUMAN CHYMASE IN COMPLEX WITH 5-fluoro-3-methyl-N-(2-methylsulfonyl-4-pyridin-4-ylphenyl)-1-benzothiophene-2-sulfonamide | | Authors: | Banner, D.W., Benz, J.M., Schlatter, D., Hilpert, H. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 7h6f | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | THE 1.25 A CRYSTAL STRUCTURE OF HUMAN CHYMASE IN COMPLEX WITH 3-[2-(dimethylamino)-2-oxoethyl]-1-[(5-fluoro-1-benzothiophen-3-yl)methyl]indole-2-carboxylic acid (INDOLE 2-CARBOXYLIC ACID) | | Authors: | Banner, D.W., Benz, J.M., Schlatter, D., Hilpert, H. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 7h6g | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | THE 1.21 A CRYSTAL STRUCTURE OF HUMAN CATHEPSIN G IN COMPLEX WITH N-[2-[6-fluoro-2-[(4-hydroxy-5-methyl-2-oxo-5-phenylfuran-3-yl)-phenylmethyl]-1H-indol-3-yl]ethyl]acetamide | | Authors: | Banner, D.W., Benz, J.M., Schlatter, D., Hilpert, H. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 7h6h | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | THE 1.94 A CRYSTAL STRUCTURE OF HUMAN CATHEPSIN G IN COMPLEX WITH 1-[(7-fluoronaphthalen-1-yl)methyl]-3-[[methoxycarbonyl(methyl)amino]methyl]indole-2-carboxylic acid | | Authors: | Banner, D.W., Benz, J.M., Schlatter, D., Hilpert, H. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 7h6i | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | THE 2.10 A CRYSTAL STRUCTURE OF HUMAN CHYMASE IN COMPLEX WITH 5-fluoro-3-(methanesulfonamidomethyl)-1-(naphthalen-1-ylmethyl)indole-2-carboxylic acid | | Authors: | Banner, D.W., Benz, J.M., Schlatter, D., Hilpert, H. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 9f1h | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Deposition date: | 2024-04-19 |
|
| PDBID: | 9f1p | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-04-19 | | Release date: | 2025-10-19 |
|
| PDBID: | 9f1q | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z73 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of AF9 in complex with H3K9la peptide | | Authors: | Li, H.T., Ma, H.D. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z70 | | Status: | HPUB -- hold until publication | | Title: | State 1 (S1) of yeast 80S ribosome bound to 2 tRNAs during mRNA decoding | | Authors: | Cheng, J., Wu, C.L., Li, J.X., Zhang, X.Z. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z6t | | Status: | HPUB -- hold until publication | | Title: | Structure of XBB.1.16 RBD in complex with antibody CYFN1006-1. | | Authors: | Wang, Y.J., Sun, L. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z6x | | Status: | HPUB -- hold until publication | | Title: | Structure of EG.5.1 RBD in complex with antibody CYFN1006-2. | | Authors: | Wang, Y.J., Sun, L. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z6r | | Status: | HPUB -- hold until publication | | Title: | Structure of XBB.1.16 S trimer with 3 down-RBDs complex with antibody CYFN1006-1. | | Authors: | Wang, Y.J., Sun, L. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z6s | | Status: | HPUB -- hold until publication | | Title: | Structure of XBB.1.16 S trimer with 2 down-RBDs complex with antibody CYFN1006-1. | | Authors: | Wang, Y.J., Sun, L. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z6n | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z6l | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z6m | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z7a | | Status: | HOLD -- hold until a certain date | | Title: | Open Barrel Structure of Translin from Trichoderma virens | | Authors: | Kumari, S., Gupta, G.D. | | Deposition date: | 2024-04-19 | | Release date: | 2025-04-19 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMAAPPPALLDPSIFASLEAKLEEETQIRDTLSQLIQRLDRAVATAQGLLSRVHSTPRSRYPQLVSQVEAAVKEEAAIISELDTVASKHPYYKYNQRWTRSMQHAIGTAIYCAWLGGFPSQSSESEASSPAEIGRLLTLEEVGTIFSVPTNLKDRDAFHITIEEYLLSLVDLTQDLSRLATNSVTLGDFQLPLTISAFVKDLFAGFQLLNLKNDIIRKRADSVKYEVKRVEDIVYDLSLRGLIQRPGAGDTEMEAAE
|
|
| PDBID: | 8z6e | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-04-19 | | Release date: | 2025-04-19 |
|
| PDBID: | 8z6d | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-04-19 | | Release date: | 2025-04-19 |
|
