| PDBID: | 9qxu | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-16 |
|
| PDBID: | 9qxv | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-16 |
|
| PDBID: | 9qxx | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-16 |
|
| PDBID: | 9qxz | | Status: | HPUB -- hold until publication | | Title: | Structure of human NONO bound to (R)-SKBG-1 in p212121 | | Authors: | Fribourg, S., Fribourg, S. | | Deposition date: | 2025-04-16 |
|
| PDBID: | 9qxq | | Status: | HPUB -- hold until publication | | Title: | native structure of full-length pesticidal protein Cry1Ca18 at pH9, from crystals formed in vivo | | Authors: | Best, H.L., Williamson, L.J., Rizkallah, P.J., Oberthur, D., Crickmore, N., Berry, C. | | Deposition date: | 2025-04-16 |
|
| PDBID: | 9qxn | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-16 |
|
| PDBID: | 9qy2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-16 |
|
| PDBID: | 9qy0 | | Status: | HPUB -- hold until publication | | Title: | Human N-myristoyltransferase (NMT1) with Myristoyl-CoA and photoactive arylazopyrazole inhibitor LD162 | | Authors: | Perrett, S., Van thor, J.J. | | Deposition date: | 2025-04-16 |
|
| PDBID: | 9qy3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-16 |
|
| PDBID: | 9qy4 | | Status: | HPUB -- hold until publication | | Title: | GT108 family enzyme from Chlamydia abortus in complex with mannose-1-phosphate (M1P) | | Authors: | Males, A., Ralton, J.E., Kaur, A., Butriss, K., Sobala, L.F., Sharma, M., Moroz, O.V., Williams, S.J., McConville, M.J., Davies, G.J. | | Deposition date: | 2025-04-16 |
|
| PDBID: | 9uid | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9uie | | Status: | HPUB -- hold until publication | | Title: | Electronic microscopy structure of human schlafen14-E211A dimer in complex with dsRNA | | Authors: | Mengyun, L., Dapeng, S., Wei, H., Yumei, W., Sheng, C. | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9uil | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9uia | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9uhz | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9ui0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9ui7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9ui9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9ui4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9ui5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9ui8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9ui1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9ui3 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the human adenosine A2A receptor bound to the agonist adenosine resolved via the fusion/crosslinking strategy | | Authors: | Han, S.C., Li, M.H. | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9ui2 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Thermus thermophilus HB8 transaldolase | | Authors: | Kamitori, S. | | Deposition date: | 2025-04-15 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMELYLDTASLEEIREIAAWGVLSGVTTNPTLVAKAFAAKGEALTEEAFAAHLRAICETVGGPVSAEVTALEAEAMVAEGRRLAAIHPNIVVKLPTTEEGLKACKRLSAEGIKVNMTLIFSANQALLAARAGASYVSPFLGRVDDISWDGGELLREIVEMIQVQDLPVKVIAASIRHPRHVTEAALLGADIATMPHAVFKQLLKHPLTDIGLKRFLEDWEKVKP
|
|
| PDBID: | 9ui6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-15 |
|
