PDBID: | 9k2r | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-10-18 |
|
PDBID: | 9k37 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-10-18 |
|
PDBID: | 9k2z | Status: | HPUB -- hold until publication | Deposition date: | 2024-10-18 |
|
PDBID: | 9k2y | Status: | HPUB -- hold until publication | Title: | Human IgG1 Fc fragments, mutant (2CT1.1) | Authors: | Kim, J.-S., Kim, J.-W. | Deposition date: | 2024-10-18 |
|
PDBID: | 9k30 | Status: | HPUB -- hold until publication | Deposition date: | 2024-10-18 |
|
PDBID: | 9k31 | Status: | HPUB -- hold until publication | Deposition date: | 2024-10-18 |
|
PDBID: | 9k32 | Status: | HPUB -- hold until publication | Deposition date: | 2024-10-18 |
|
PDBID: | 9k34 | Status: | HPUB -- hold until publication | Title: | Human IgG1 Fc fragments, mutant (2CT1.9) | Authors: | Kim, J.-S., Kim, J.-W. | Deposition date: | 2024-10-18 |
|
PDBID: | 9k3c | Status: | HPUB -- hold until publication | Deposition date: | 2024-10-18 |
|
PDBID: | 9k2t | Status: | HPUB -- hold until publication | Deposition date: | 2024-10-18 |
|
PDBID: | 9k2u | Status: | HPUB -- hold until publication | Deposition date: | 2024-10-18 |
|
PDBID: | 9k2s | Status: | HPUB -- hold until publication | Deposition date: | 2024-10-18 |
|
PDBID: | 9k3f | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of the unliganded human melanocortin receptor 3 (MC3R)-Gs complex | Authors: | Feng, W.B., Zhou, Q.T., Zheng, C., Yang, D.H., Wang, M.W. | Deposition date: | 2024-10-18 |
|
PDBID: | 9k3h | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of the unliganded human melanocortin receptor 5 (MC5R)-Gs complex | Authors: | Feng, W.B., Zhou, Q.T., Zheng, C., Yang, D.H., Wang, M.W. | Deposition date: | 2024-10-18 |
|
PDBID: | 9k35 | Status: | HPUB -- hold until publication | Title: | Crystal structure of a (R)-selective transaminase (RTA) from Sphingopyxis sp. | Authors: | Qin, F.Y., Lee, K.M., Wong, K.B., Lee, K.H. | Deposition date: | 2024-10-18 |
|
PDBID: | 9k2q | Status: | AUTH -- processed, waiting for author review and approval | Title: | Preload capsid of phiYY, a prokaryotic dsRNA virus | Authors: | Huyan, Y.N., Meng, G. | Deposition date: | 2024-10-18 |
|
PDBID: | 9k33 | Status: | HPUB -- hold until publication | Deposition date: | 2024-10-18 |
|
PDBID: | 9e0l | Status: | HPUB -- hold until publication | Deposition date: | 2024-10-18 |
|
PDBID: | 9e0q | Status: | HPUB -- hold until publication | Deposition date: | 2024-10-18 |
|
PDBID: | 9e0r | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of a single nucleosome (1) focus of human DNMT3A2-DNMT3B3 complex bound to di-nucleosome | Authors: | Xie, X., Zhou, X.E., Worden, E.J., Jones, P.A. | Deposition date: | 2024-10-18 |
|
PDBID: | 9e0s | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of a the periplasmic insert from Myxococcus TAtC | Authors: | Deme, J.C., Bryant, O.J., Berks, B.C., Lea, S.M. | Deposition date: | 2024-10-18 | Sequence: | >Entity 1 (MSE)GS(MSE)FTFLLNEEETLALEQRLDTARLRADDALRFLRLGEAEEAGRIAKETSTQLRAEGQGQAPAPEVAPAASVE(MSE)TGRLDGLGRLLDAASVGYGAQSRGVLRQAVEKRVEAVTAYEKKDFAAAAAA(MSE)DGSASLLAGIAPTRTEELAGLWRLEKELATAHAAHEAARWTRP(MSE)LS(MSE)HEQLSENLYFQ
|
|
PDBID: | 9h43 | Status: | HPUB -- hold until publication | Deposition date: | 2024-10-17 |
|
PDBID: | 9h3j | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-10-17 |
|
PDBID: | 9k29 | Status: | HPUB -- hold until publication | Title: | Structure of the Salmonella flagellar FliPQR complex reconstituted in the peptidisc | Authors: | Kinoshita, M., Miyata, T., Makino, F., Imada, K., Namba, K., Minamino, T. | Deposition date: | 2024-10-17 |
|
PDBID: | 9k2i | Status: | HPUB -- hold until publication | Deposition date: | 2024-10-17 |
|